NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS36052.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
36052.1 Public Mus musculus 10 Ppp1r12a 21 106 86 CCDS HistoryNCBI Gene:17931Re-query CCDS DB by CCDS ID:36052.1Re-query CCDS DB by GeneID:17931See the combined annotation on chromosome 10 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 36052.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000070663 ENSMUSP00000069257 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000070663Link to Ensembl Protein Viewer:ENSMUSP00000069257Re-query CCDS DB by Nucleotide ID:ENSMUST00000070663Re-query CCDS DB by Protein ID:ENSMUSP00000069257
Original member NCBI NM_027892.2 NP_082168.1 Updated not alive Link to Nucleotide Sequence:NM_027892.2Link to Protein Sequence:NP_082168.1Re-query CCDS DB by Nucleotide ID:NM_027892Re-query CCDS DB by Protein ID:NP_082168
Current member NCBI NM_027892.3 NP_082168.1 Accepted alive Link to Nucleotide Sequence:NM_027892.3Link to Protein Sequence:NP_082168.1Re-query CCDS DB by Nucleotide ID:NM_027892Re-query CCDS DB by Protein ID:NP_082168Link to BLAST:NP_082168.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_082168.1 1004 Q9DBR7-2 1004 100% 0 0

Chromosomal Locations for CCDS 36052.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 10 (NC_000076.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10See the combined annotation on chromosome 10 in Sequence Viewer

Chromosome Start Stop Links
10 108162400 108162636 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 108198833 108198963 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 108214388 108214506 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 108230437 108230596 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 108233999 108234143 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 108240105 108240179 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 108240779 108240867 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 108241121 108241278 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 108243006 108243130 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 108249435 108249650 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 108250914 108251008 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 108251840 108251944 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 108252757 108252924 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 108253325 108253495 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 108259756 108259846 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 108260836 108261036 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 108261245 108261416 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 108262310 108262431 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 108264703 108264768 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 108267404 108267420 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 108268572 108268707 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 108269254 108269358 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 108271722 108271769 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 108273395 108273425 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 108274138 108274169 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3015 nt):
ATGAAGATGGCGGACGCGAAGCAGAAGCGGAACGAGCAGCTGAAGCGCTGGATCGGCTCCGAGACGGACC
TC
GAGCCGCCCGTGGTGAAGCGCCAGAAGACCAAGGTGAAGTTCGACGATGGCGCCGTCTTCCTCGCCGC
C
TGCTCCAGCGGCGACACGGACGAGGTCCTCAAGCTGCTGCACCGCGGCGCCGACATCAATTACGCCAAT
GTG
GACGGACTCACCGCCCTGCACCAGGCTTGCATTGATGACAATGTTGATATGGTGAAGTTTCTGGTAG
AA
AATGGAGCAAATATCAATCAACCTGACAATGAAGGCTGGATACCACTCCATGCAGCTGCTTCCTGTGG
A
TATCTCGATATTGCAGAGTTTTTGATTGGTCAAGGAGCACATGTAGGAGCTGTCAACAGTGAAGGAGAC
ACA
CCTTTAGATATTGCAGAGGAGGAGGCGATGGAAGAGCTACTTCAAAATGAGGTTAATCGGCAAGGTG
TT
GATATAGAAGCGGCTCGGAAAGAGGAGGAGCGGGTAATGCTAAGAGACGCGAGGCAGTGGTTAAACAG
C
GGCCACATCAGTGACGTCCGGCATGCAAAGTCCGGGGGCACAGCACTCCACGTGGCGGCCGCCAAAGGC
TAT
ACAGAAGTGTTAAAACTTTTAATACAGGCAGGCTATGATGTTAATATTAAAGATTATGATGGCTGGA
CA
CCTCTTCATGCTGCAGCTCATTGGGGTAAAGAAGAAGCATGTCGGATTTTAGTGGACAATCTGTGTGA
T
ATGGAGACGGTCAACAAAGTGGGCCAAACAGCCTTTGATGTAGCAGATGAAGACATTTTGGGATATCTA
GAA
GAGTTGCAAAAAAAACAAACTCTGCTCCATAGTGAGAAGCGGGATAAGAAATCTCCACTGATCGAGT
CC
ACAGCAAATATGGAAAACAATCAACCACAGAAGGCTTTTAAAAACAAGGAAACGTTGATTATTGAGCC
A
GAGAAAAATGCATCTCGCATCGAGTCTCTGGAGCATGAGAAGGCTGATGAGGAGGAAGAAGGCAAGAAG
GAC
GAGTCGAGCTGTTCCAGTGAGGAGGACGAGGAGGACGATTCAGAGTCAGAGGCAGAGACAGATAAGA
CA
AAGCCCATGGCTTCTGTAAGCAATGCTCATACTTCCAGCACGCAGGCAGCCCCTGCAGCTGTTACAGC
A
CCTACTCTGTCTTCCAACCAGGGGACCCCTACATCACCTGTTAAAAAGTTTCCAATATCGACTACAAAA
ATT
TCTCCCAAAGAAGAGGAAAGAAAAGATGAGTCTCCTGCATCCTGGAGGTTAGGGCTTCGAAAGACTG
GC
AGTTACGGTGCCCTGGCTGAAATCAGTGCGTCTAAAGAAGCCCAGAAGGAGAAAGACACTGCAGGGGT
G
ATGCGGTCGGCTTCCAGTCCGAGACTCTCGTCCTCTTTGGATAATAAAGAAAAGGAGAAAGATAACAAA
GGA
ACGAGACTTGCGTATGTCACCCCTACAATCCCGAGACGACTAGCCAGTACATCTGACATTGAAGAGA
AG
GAGAACAGAGAGTCTTCAAGTTTGCGAACAAGTAGTTCTTACACAAGAAGAAAATGGGAAGATGATCT
T
AAAAAGAATAGTTCGATCAATGAAGGATCCACTTACCATAGAAGTTGCTCCTTTGGTAGAAGACAAGAT
GAT
TTGATTAGTTGTAGTGTTCCAAGCACCACATCAACACCAACAGTTACCTCTGCAGCGGGGCTTCAGA
GA
AGCCTCCCTTCCAGCACAAGCACTGCTGCAAAGACTCCCCCGGGTTCCTCCTCCGCAGGCACACAGAG
C
AGTACCTCAAATCGTTTGTGGGCTGAGGATAGTACTGAGAAAGAAAAGGACAGTGCTCCTACTGCAGTG
ACC
ATTCCTGTGGCTCCAACTGTTGTAAATGCTGCAGCTCCTTCCACCACCACCCTGACTACAACTACTG
CT
GGCACTGTTTCCGAGGTCAGGGAGAGACGCAGGTCATACCTCACTCCTGTTAGGGACGAAGAGTCTGA
A
TCCCAAAGAAAAGCAAGATCTAGACAAGCAAGACAGTCTAGACGGTCAACACAGGGGGTAACACTGACT
GAT
CTTCAGGAAGCTGAAAAAACAATAGGAAGAAGTCGTTCTACGAGAACCAGAGAACAAGAAAATGAAG
AG
AAAGAAAAAGAAGAAAAGGAAAAGCAGGATAAAGAGAAACAAGAAGAAAAGAAGGAGTCAGAAGCATC
T
AGAGAAGATGAATATAAACAAAAGTATTCAAGAACATACGATGAGACTTACACACGTTATAGACCTGTG
TCA
ACTTCAAGTTCAAGCGCTCCGTCGTCGTCCTCACTCTCTACTCTAGGCAGCACACTCTATGCCTCAA
GT
CAGCTCAACAGGCCAAACAGTCTTGTAGGTATAACCTCTGCCTACTCCCGGGGATTAGCCAAAGAAAA
C
GAGAGAGAGGGAGAGAAAAAAGAAGAGGAGAAAGAAGGGGAAGATAAGTCACAGCCTAAGTCAATCAGA
GAA
CGACGGCGACCCAGAGAAAAGCGACGGTCTACTGGAGTCTCCTTCTGGACACAAGATAGTGATGAAA
AT
GAGCAAGAGCGGCAATCGGACACTGAGGACGGCTCCAGCAAGAGAGAGACGCAGACGGATTCTGTTTC
C
AGGTATGACAGCAGTTCCACATCATCAAGTGATCGGTATGATTCCTTGCTGGGTCGCTCTGCTTCATAC
AGT
TACTTAGAAGACAGAAAACCTTACAGTAGCAGGCTAGAAAAGGATGACTCAACTGACTTCAAAAAGC
TT
TATGAACAAATTTTAGCTGAAAATGAAAAGCTAAAAGCACAGCTACATGATACAAATATGGAACTAAC
G
GATCTAAAGTTGCAGTTGGAAAAGGCTACCCAGAGACAAGAACGATTTGCTGACAGGTCACAATTGGAG
ATG
GAAAAAAGGGTGGCCGGCAAGAGTCAGTATCTTCTGGGCGGAACGAAGAGCTCTAGAAAGAAGAATA
TC
TGA


Translation (1004 aa):
MKMADAKQKRNEQLKRWIGSETDLEPPVVKRQKTKVKFDDGAVFLAACSSGDTDEVLKLLHRGADINYAN
V
DGLTALHQ
ACIDDNVDMVKFLVENGANINQPDNEGWIPLHAAASCGYLDIAEFLIGQGAHVGAVNSEGD
T
PLDIAEEEAMEELLQNEVNRQ
GVDIEAARKEEERVMLRDARQWLNSGHISDVRHAKSGGTALHVAAAKG
Y
TEVL
KLLIQAGYDVNIKDYDGWTPLHAAAHWGKEEACRILVDNLCDMETVNKVGQTAFDVADEDILGYL
E
ELQKKQTL
LHSEKRDKKSPLIESTANMENNQPQKAFKNKETLIIEPEKNASRIESLEHEKADEEEEGKK
D
ESSCSSEEDEEDDSESEAET
DKTKPMASVSNAHTSSTQAAPAAVTAPTLSSNQGTPTSPVKKFPISTTK
I
SPKEEERKDESPASWRLGLRKTGSYGALAEISASKEAQKEKDTAGVMRSASSPRLSSSLDNKEK
EKDNK
G
TRLAYVTPTIPRRLASTSDIEEKEN
RESSSLRTSSSYTRRKWEDDLKKNSSINEGSTYHRSCSFGRRQD
D
LISCSVPSTTSTPTVTSAAGLQRSLPSSTSTAAKTPPGSSSAGTQS
STSNRLWAEDSTEKEKDSAPTAV
T
IPVAPTVVNAAAPSTTTLTTTTAGTVSEVRERR
RSYLTPVRDEESESQRKARSRQARQSRRSTQGVTLT
D
LQEAEKTIGRSRSTRTREQENEEKEKEEKEKQDKEKQEEKKESEASREDEYKQKYSRTYDE
TYTRYRPV
S
TSSSSAPSSSSLSTLGSTLYASSQLNRPNSLVGITSAYSRGLAKENER
EGEKKEEEKEGEDKSQPKSIR
E
RRRPREKRRSTGVSFWTQD
SDENEQERQSDTEDGSSKRETQTDSVSRYDSSSTSSSDRYDSLLGRSASY
S
YLEDRKPYSSRLEKDDSTDFKK
LYEQILAENEKLKAQLHDTNMELTDLKLQLEKATQRQERFADRSQLE
M
EKR
VAGKSQYLLGGTKSSRKKNI



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser