NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS35936.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
35936.1 Public Mus musculus 10 Gucd1 21 106 86 CCDS HistoryNCBI Gene:68778Re-query CCDS DB by CCDS ID:35936.1Re-query CCDS DB by GeneID:68778See the combined annotation on chromosome 10 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 35936.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000039796 ENSMUSP00000043000 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000039796Link to Ensembl Protein Viewer:ENSMUSP00000043000Re-query CCDS DB by Nucleotide ID:ENSMUST00000039796Re-query CCDS DB by Protein ID:ENSMUSP00000043000
Original member Current member EBI,WTSI OTTMUST00000078804 OTTMUSP00000041939 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000078804Link to Vega Protein Viewer:OTTMUSP00000041939Re-query CCDS DB by Nucleotide ID:OTTMUST00000078804Re-query CCDS DB by Protein ID:OTTMUSP00000041939
Original member NCBI NM_175133.1 NP_780342.1 Updated not alive Link to Nucleotide Sequence:NM_175133.1Link to Protein Sequence:NP_780342.1Re-query CCDS DB by Nucleotide ID:NM_175133Re-query CCDS DB by Protein ID:NP_780342
Current member NCBI NM_175133.2 NP_780342.1 Accepted alive Link to Nucleotide Sequence:NM_175133.2Link to Protein Sequence:NP_780342.1Re-query CCDS DB by Nucleotide ID:NM_175133Re-query CCDS DB by Protein ID:NP_780342Link to BLAST:NP_780342.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_780342.1 239 Q8BZI6 239 100% 0 0

Chromosomal Locations for CCDS 35936.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 10 (NC_000076.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10See the combined annotation on chromosome 10 in Sequence Viewer

Chromosome Start Stop Links
10 75508878 75508969 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 75509592 75509833 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 75510032 75510123 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 75511121 75511286 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 75512072 75512156 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 75517154 75517196 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (720 nt):
ATGAGGACGGAGGCAGAGGCAGCGGGGCAGCCGCTCGAGCCCGGGGACTTTGTGCAGCTGCCTGTGCCTA
TC
ATCCAGCAGCTATATCACTGGGACTGTGGCCTGGCCTGCTCCAGGATGGTGCTTCGGTACCTGGGCCA
G
CTCGACGACGGGGAGTTTGAAAACGCCCTGCAGGAGCTGCAGCTGACCAGGAGCATCTGGACCATCGAC
CTG
GCCTACCTGATGCGCCACTTTGGTGTGAGACACCGCTTCTGTACCCAGACTCTGGGTGTTGACAAGG
GT
TACAAAAACCAGTCCTTCTACAGGAAGCACTTTGACACAGAGGAGACCCGAGTGAACCAGCTGTTTGC
A
CAGGCCAAGGCCTGCAAGGTGCAAGTGGAGAAATGCACAGTGAGTGTGCAGGACATCCAAGTACACCTG
GCG
CAGGGCCATGTGGCCATTGTGTTGGTGAATTCCGGGGTGCTACACTGCGACCTGTGCTCCAGCCCTG
TC
AAGTACTGCTGCTTTACTCCCAGTGGCCACCGCTGCTTCTGCCGCACCCCCGACTACCAAGGCCACTT
C
ATCGTCCTGCGTGGCTATAACAGGGCTACCGGCTGCATCTTCTATAACAACCCAGCCTATGCTGACCGG
ATG
TGCAGCACCAGCATCAGTAACTTTGAGGAGGCCAGAACTAGCTACGGCACAGATGAGGACATCCTCT
TT
GTCTACCTGGACAGCTGA


Translation (239 aa):
MRTEAEAAGQPLEPGDFVQLPVPIIQQLYHWDCGLACSRMVLRYLGQLDDGEFENALQELQLTRSIWTID
L
AYLMRHFGVRHRFCTQTLGVDKGYKNQ
SFYRKHFDTEETRVNQLFAQAKACKVQVEKCTVSVQDIQVHL
A
QGHVAIVLVNSGVLHCDLCSSPVKYCCFTPSGHRCFCRTPDYQGHFIVLRGYNRATGCIFYNNPAYAD
R
M
CSTSISNFEEARTSYGTDEDILFVYLDS




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser