NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS35930.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
35930.1 Public Mus musculus 10 Rhobtb1 23 108 98 CCDS HistoryNCBI Gene:69288Re-query CCDS DB by CCDS ID:35930.1Re-query CCDS DB by GeneID:69288See the combined annotation on chromosome 10 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 35930.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000020101.11 ENSMUSP00000020101.5 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000020101.11Link to Ensembl Protein Viewer:ENSMUSP00000020101.5Re-query CCDS DB by Nucleotide ID:ENSMUST00000020101Re-query CCDS DB by Protein ID:ENSMUSP00000020101
Original member Current member EBI,WTSI ENSMUST00000067908.13 ENSMUSP00000065095.7 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000067908.13Link to Ensembl Protein Viewer:ENSMUSP00000065095.7Re-query CCDS DB by Nucleotide ID:ENSMUST00000067908Re-query CCDS DB by Protein ID:ENSMUSP00000065095
Original member Current member EBI,WTSI ENSMUST00000164034.7 ENSMUSP00000132068.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000164034.7Link to Ensembl Protein Viewer:ENSMUSP00000132068.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000164034Re-query CCDS DB by Protein ID:ENSMUSP00000132068
Original member Current member NCBI NM_001081347.1 NP_001074816.1 Accepted alive Link to Nucleotide Sequence:NM_001081347.1Link to Protein Sequence:NP_001074816.1Re-query CCDS DB by Nucleotide ID:NM_001081347Re-query CCDS DB by Protein ID:NP_001074816Link to BLAST:NP_001074816.1
Original member Current member NCBI NM_001252636.1 NP_001239565.1 Accepted alive Link to Nucleotide Sequence:NM_001252636.1Link to Protein Sequence:NP_001239565.1Re-query CCDS DB by Nucleotide ID:NM_001252636Re-query CCDS DB by Protein ID:NP_001239565Link to BLAST:NP_001239565.1
Original member Current member NCBI NM_001252637.1 NP_001239566.1 Accepted alive Link to Nucleotide Sequence:NM_001252637.1Link to Protein Sequence:NP_001239566.1Re-query CCDS DB by Nucleotide ID:NM_001252637Re-query CCDS DB by Protein ID:NP_001239566Link to BLAST:NP_001239566.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001074816.1 695 Q9DAK3 695 100% 0 0
NP_001239565.1 695 Q9DAK3 695 100% 0 0
NP_001239566.1 695 Q9DAK3 695 100% 0 0

Chromosomal Locations for CCDS 35930.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 10 (NC_000076.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10See the combined annotation on chromosome 10 in Sequence Viewer

Chromosome Start Stop Links
10 69248781 69248972 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 69249625 69249728 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 69266187 69266372 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 69269903 69270873 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 69272739 69272857 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 69279345 69279495 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 69285687 69285775 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 69288950 69289055 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 69289520 69289689 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2088 nt):
ATGGACTCTGACATGGACTACGAACGACCCAACGTTGAGACCATCAAGTGCGTGGTCGTGGGCGACAACG
CC
GTAGGGAAGACGCGCCTCATCTGTGCCCGGGCCTGCAACACCACCCTGACACAGTACCAGCTGCTGGC
C
ACCCATGTGCCCACCGTGTGGGCCATTGATCAGTACCGTGTCTGCCAGGAGGTCCTGGAGCGGTCCAGG
GAT
GTCGTCGATGAAGTGAGCATCTCCCTCAGGCTTTGGGACACGTTTGGAGATCACCACAAAGACAGGC
GG
TTCGCATATGGCAGGTCCGATGTTGTGGTCCTCTGCTTTAGCATCGCGAACCCCAACTCCCTAAATCA
T
GTGAAAACCATGTGGTATCAAGAAATCAAGCACTTTTGCCCTCGAACGCCCGTCGTCCTGGTTGGCTGC
CAG
CTAGACCTCCGCTACGCCGACCTGGAGGCTGTTAACCGGGCCAGACGCCCCTTAGCAAGGCCCATAA
AG
AGAGGTGACATTTTGCCCCCAGAAAAAGGCCGCGAGGTGGCGAAGGAACTTGGCATCCCGTACTACGA
G
ACCAGCGTGTTTGACCAGTTTGGCATCAAGGACGTGTTCGACAATGCCATCCGAGCAGCCCTCATCTCC
CGC
CGGCACCTGCAGTTCTGGAAATCCCACTTGAAAAAAGTCCAGAAGCCTCTGCTTCAGGCGCCCTTCC
TA
CCTCCGAAAGCTCCTCCCCCGGTCATCAAGGTCCCCGAGTGTCCGTCTGCGGGGACCAGCGATGCTGC
C
TGTTTACTGGACAACCCCCTGTGCGCCGACGTCCTCTTCGTTCTCCATGACGAGGAGCACATCTTTGCG
CAC
CGCATTTACCTCGCTACCTCTTCTTCCAAATTCTACGACCTTTTTTTAATGGAGTGTGAAGAATCCC
CT
TGTTGGGGTGGAGGAGCTGGTGAGGAGGTGCCGTGCAGGGATTTTCAGGGGCGGACGCAGAGTCTTGG
A
TCAGCCGAGGAAGGGAAGGAGGGCCCCCAGAGGACCCCTCAGGCTGACCCAGGAGCGTCTTCAGGCCAG
GAC
CTGCCTGAGAGTTTGGCTTTGCAGATGGAAGCCTCGGGTTCCGAGGGACACGCCCTGTCCGGCTGGA
GC
AAGGGGTTTGTCAGCATGCACAGGGAGGTGCGGGTCAACCCCATTTCCAAGCGGGTGGGCCCAGTGAC
C
GTGGTCAGGCTGGACCCATCGATGCAGTCAGGCCCTTTCCGGACCCTGCTGAGATTCCTCTACTCTGGG
CAG
CTGGACGAAAAGGAAAAAGATCTGCTGGGGCTGGCTCAGATGGCCGAGGTCCTGGAGATGTTTGATC
TG
AGGATGATGGTAGAGAATATCATGAACAAGGAGGCTTTTATGAACCAGGAGATCACGAAAGCCTTCCA
C
GTCCGGAAAGCCAATCGGATCAAAGAATGTCTCAGCAAGGGCACCTTCTCAGACGTGACATTTACCTTG
GAT
GACGGAGCCATCAGCGCCCACAAGCCGCTGCTGATCTGTAGCTGCGAATGGATGGCGGCCATGTTCG
GG
GGTTCCTTTGTGGAAAGCGCCAACCGTGAGGTTCACCTCCCAAATATAAACAAGATGTCGATGCAGGC
G
GTGTTGGAATACCTCTACACCAAGCAGTTGTCACCCAACTTGGACCTGGACCCCCTGGAGTTAATTGCC
TTG
GCAAACAGATTTTGCCTGACACACTTGGTTGCTCTCGTAGAGCAGCATGCTGTCCAGGAGCTCACCA
AG
GCCGCTGTCAGTGGTGTGAGCATCGATGGTGAAGTTCTCTCCTACTTGGAGCTGGCACAGTTTCACAA
T
GCCAATCAGCTAGCTGCCTGGTGTTTGCATCACATCTGCACCAACTACAACAGCGTCTGTTCCAAGTTC
CGC
AAGGAAATCAAATCCAAGTCAGCAGACAACCAGGAGTACTTTGAGCGGCACCGCTGGCCCCCTGTGT
GG
TACCTGAAGGAGGAAGACCACTACCAGCGTGTGAAGAGGGAACGAGAGAAAGAGGACCTGGCGCTGAA
C
AAGCACCATTCAAGGAGAAAGTGGTGTTTCTGGCATTCGTCCCCAGCTGTCGCCTGA


Translation (695 aa):
MDSDMDYERPNVETIKCVVVGDNAVGKTRLICARACNTTLTQYQLLATHVPTVWAIDQYRVCQEVLERSR
D
VVDEVSISLRLWDTFGDHHKDRRFAYG
RSDVVVLCFSIANPNSLNHVKTMWYQEIKHFCPRTPVVLVGC
Q
LDLRYADLEAVNRARRPLA
RPIKRGDILPPEKGREVAKELGIPYYETSVFDQFGIKDVFDNAIRAALIS
R
RHLQFWKSHLKKVQKPLLQAPFLPPKAPPPVIKVPECPSAGTSDAACLLDNPLCADVLFVLHDEEHIFA
H
RIYLATSSSKFYDLFLMECEESPCWGGGAGEEVPCRDFQGRTQSLGSAEEGKEGPQRTPQADPGASSGQ
D
LPESLALQMEASGSEGHALSGWSKGFVSMHREVRVNPISKRVGPVTVVRLDPSMQSGPFRTLLRFLYSG
Q
LDEKEKDLLGLAQMAEVLEMFDLRMMVENIMNKEAFMNQEITKAFHVRKANRIKECLSKGTFS
DVTFTL
D
DGAISAHKPLLICSCEWMAAMFGGSFVESANRE
VHLPNINKMSMQAVLEYLYTKQLSPNLDLDPLELIA
L
ANRFCLTHLVALV
EQHAVQELTKAAVSGVSIDGEVLSYLELAQFHNANQLAAWCLHHICTNYNSVCSKF
R
KEIKSKSA
DNQEYFERHRWPPVWYLKEEDHYQRVKREREKEDLALNKHHSRRKWCFWHSSPAVA



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser