NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS35784.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
35784.1 Public Mus musculus 1 Tagln2 23 108 98 CCDS HistoryNCBI Gene:21346Re-query CCDS DB by CCDS ID:35784.1Re-query CCDS DB by GeneID:21346See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 35784.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000111228.1 ENSMUSP00000106859.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000111228.1Link to Ensembl Protein Viewer:ENSMUSP00000106859.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000111228Re-query CCDS DB by Protein ID:ENSMUSP00000106859
Original member Current member EBI,WTSI ENSMUST00000111230.7 ENSMUSP00000106861.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000111230.7Link to Ensembl Protein Viewer:ENSMUSP00000106861.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000111230Re-query CCDS DB by Protein ID:ENSMUSP00000106861
Original member Current member NCBI NM_178598.2 NP_848713.1 Accepted alive Link to Nucleotide Sequence:NM_178598.2Link to Protein Sequence:NP_848713.1Re-query CCDS DB by Nucleotide ID:NM_178598Re-query CCDS DB by Protein ID:NP_848713Link to BLAST:NP_848713.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_848713.1 199 Q9WVA4 199 100% 0 0

Chromosomal Locations for CCDS 35784.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 1 (NC_000067.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 172505148 172505327 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 172505761 172505935 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 172506186 172506288 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 172506567 172506708 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (600 nt):
ATGGCCAACAGGGGACCTTCCTACGGCCTGAGCCGAGAGGTGCAGCAGAAGATTGAGAAGCAGTACGACG
CG
GATCTGGAGCAGATCCTCATCCAGTGGATCACCACTCAGTGCCGTGAGGACGTGGGCCAGCCCCAGCC
T
GGCCGTGAGAACTTCCAGAAGTGGCTCAAGGACGGCACGGTTCTGTGCAAGCTTATTAATTCACTGTAT
CCT
GAGGGGCAGGCCCCAGTAAAGAAGATCCAGGCCTCTTCGATGGCCTTCAAGCAGATGGAGCAGATCT
CC
CAGTTCCTGCAGGCAGCCGAGCGCTATGGCATTAACACCACGGACATCTTCCAGACTGTGGATCTCTG
G
GAAGGAAAGAACATGGCTTGTGTGCAGCGGACACTAATGAACCTGGGTGGGCTGGCAGTAGCCAGGGAC
GAT
GGGCTCTTCTCTGGGGATCCCAACTGGTTTCCTAAGAAATCCAAGGAGAACCCTCGGAACTTCTCGG
AC
AACCAGTTGCAAGAGGGCAAGAACGTGATTGGGTTGCAGATGGGCACCAACCGTGGAGCATCTCAGGC
C
GGCATGACCGGCTATGGGATGCCACGGCAGATCCTCTGA


Translation (199 aa):
MANRGPSYGLSREVQQKIEKQYDADLEQILIQWITTQCREDVGQPQPGRENFQKWLKDGTVLCKLINSLY
P
EGQAPVKKIQASSMAFKQMEQISQFLQAAERYGINTTDIFQTVDLWE
GKNMACVQRTLMNLGGLAVARD
D
GLFSGDPNWFP
KKSKENPRNFSDNQLQEGKNVIGLQMGTNRGASQAGMTGYGMPRQIL



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser