NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS35511.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
35511.1 Public Mus musculus 1 Cspp1 23 108 98 CCDS HistoryNCBI Gene:211660Re-query CCDS DB by CCDS ID:35511.1Re-query CCDS DB by GeneID:211660See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 35511.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000071087.11 ENSMUSP00000068804.5 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000071087.11Link to Ensembl Protein Viewer:ENSMUSP00000068804.5Re-query CCDS DB by Nucleotide ID:ENSMUST00000071087Re-query CCDS DB by Protein ID:ENSMUSP00000068804
Original member Current member NCBI NM_026493.3 NP_080769.3 Accepted alive Link to Nucleotide Sequence:NM_026493.3Link to Protein Sequence:NP_080769.3Re-query CCDS DB by Nucleotide ID:NM_026493Re-query CCDS DB by Protein ID:NP_080769Link to BLAST:NP_080769.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_080769.3 1197 B2RX88-4 1197 100% 0 0

Chromosomal Locations for CCDS 35511.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 1 (NC_000067.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 10045086 10045184 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 10047424 10047526 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 10058720 10058823 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 10064333 10064413 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 10065323 10065421 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 10066426 10066820 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 10074860 10074946 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 10077172 10077242 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 10082253 10082346 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 10083501 10083558 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 10085747 10085952 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 10088051 10088184 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 10088882 10088960 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 10090188 10090317 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 10095866 10096013 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 10104212 10104364 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 10108369 10108481 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 10112393 10112542 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 10112876 10113022 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 10113603 10113707 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 10116018 10116084 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 10116614 10116731 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 10126340 10126479 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 10127423 10127563 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 10129986 10130032 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 10132454 10132517 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 10133164 10133273 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 10134092 10134230 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 10135934 10136145 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3594 nt):
ATGGCAGATAGCTTGGATGAATTTATTGAAGAGCAAAAAGCGAAACTGGCCAAAGACAAAGCAGAATTGG
AA
AGTGATCCACCGTACATGGAGATGAAGGGAAAGGCGTCAGAGAAACTCTCTGAAAACAGTAAAATATT
A
ATCTCTATGGCTAAGGAGAACATTCCACCAAGCAGCCAACAACAGCCCAAGGGACCCTTAGGAATTGAA
TAT
GGCTTAAGTTTACCGCTTGGAGAAGATTATGAACAGAAGAAACATAAATTAAAAGAAGAATTGAGGC
AA
GATTATAGACGATATCTTACTCAGAAAAATTTCCTATCTACTGGTGAAACAGACCCATCTACTCTGGG
A
GTTTCTCTTCCCATTGATGAGCGGTTATCTGCCAAGGAAAGATTGAAACTTGAACGCAACCGAGAATAC
AAT
CAGTTTCTCAGGGGTAAGGCAGAATCCACAGAAAAAGTCAGACAGGTAGAAAAGAATATTGAGCCTA
AG
AGTCAAAGAAATAAAAACCCTATTAGTCAAGGTAAATCTGATCTACCTTTACAAATACAGACTGCATA
C
ACACATTCAGAGGGACCCTGGCTAAGCCGGCAAGAGGAGGGCCTGTACCGACAGCTAGATGGTGAAATT
GAA
TTAAGGAGCAGAAGACCGCTTAAACAAACAAAGGAAGAAGTAGGCATTTCTGGTGCAGAACATCCAA
GC
CTTTCTGGCAGCGCTGGTGTCCCAGAGAGAAGAGCCCGCAGGGCTAACGGGGAGCGGGTGCTTGACAG
A
CAACATTGCAGAGCCGACCGAGACCCTGGTGTGAGTGAAGACATGGACGAGAGGTTTAGATTTGAAAGT
GAT
TTTGATAGAAGACTTTTGAGAGTGTATACAAATGGCAGGCCGCATGGGAGCAGACGAGGGTATGTGG
AT
GGGGATGATGTCCCAGAAGAGCCAAACACACAGATCTCAGCTGCTGAAAATAAAAGTGTTCACTGTAA
T
GGACCACCCAGATCTGCTGATCTCGATATCACAAGTCCATTTGCAGGCATGCTCTTTGGAGGTGAAGAT
CGA
GAACTTACCAAGAGAAGGAAGGAGAAATATAGGCAAGAACTACTAGAACAGATAGCTGAGCAACAGA
AG
AAGAAGAGACGAGAAAAAGATTTAGCATTTGGAATTACAACTTCTGGAGTACAAGACCCTGAAAAATC
G
CCTGATAGACTAAAGCAGTTTAGTTTGACACCAAGACACTTTGAAGAGATGCCACCTGAGAGGCCCAGA
GTA
GCTTTCCAGACACCTCCCCCTCCCTTCTCTGCCCCGTCTAGCCCATCCGTCCCACCAGTTCATTCCG
CC
CCTTCTCACAATGAAGACTTGCACAGTGGACTCGGCAGCACCCTTGGTGAACTGGCGCATCCCAGGGT
T
CTGCCTGTGCCTCTGAATCCACCCCCGCCTCCGCTCCTTGCCCCTCCAGCTTCTAACTATCGAACTCCT
TAC
GATGATGCGTACTATTTTTACGGTGCCAGAAATACACTGGATCCCAATATTGTATACTATGGTTCAG
GA
ATGATTGGAGGACAGCCTGCCCCTCATGTCTCTGCCCCTGTCACTCACCAGGTAGCACCGCCAGCTGT
G
AATACTGTTGGACAGAATGAACAGAAAGTTCTTAGTGATGGACTCAGGAATTCAGGACTGGTCTTTGAG
GAT
AAGCCAAAACCTTCTACACAGTCGCTTCAGTCTTACCAAGAAGCTTTGCAGGAGCAGATTCGGGAAA
GA
GAAGCAAGAAGGAAGAAAGAACGTTTAGAAAAAGAAGAATATGAAGCTAAATTAGAAGCCGAAATGAG
G
ATCTACAACCCCTGGGGGAAGGGCGGAGGTGGTGCTCCTCTCAGAGACGCCAAAGGAAATCTGATAACT
GAT
TTGAATAGGATGCACAGACAGAATATAGATGCCTACCATAACCCAGATGCAAGAACATATGAAGATA
AA
AGGGCTGTTGTATCTATAGACCAAAATTTAGCCACTTCAAATGCTGAGAACCTAGAAGATTCTGCAAA
T
AAAAACTCAGGTCCTTTGCAAACACAAAGCTCTCCTTTTGCCCGGGGAAACACATTTGGTGAGCCACTC
AGC
GAGCTTCAGATTAAACAGCAAGAATTATACAAGAATTTTCTTCGTTTTCAGATTGAGGAAAAGAGAC
AA
AGAGAAGAAGCCGAGCGCGAGAAGCTGAGAGTTGCTGAAGAGAAGGAAGAAAAGCGGCTTGCGGAGCA
G
AGGGCAAGGATTCAGCAAGAGTATGAGGAGGAGCAGGAGCGGAGGAGGGAGAAGGAGGAGGAGCAAAGG
TTG
AAAAATGAAGAACTTATTCGGTTAGCTGAAGAGAGGCGAAAGGAAGCGGAAAGAAAGAAGAAAGAGG
AG
GAAGAAAAACATAACTTGCAACTTCAGCATTACTATGAGAGAGAAAATATTATCGGAGATGAAACAAA
G
CACTTGAGACAGCCTTCTCCTGTAGTTCCTGCTCTTCAGAACAAAATTGCAAGCAAACTCCAAAGACCT
CCT
TCAGTCGACACCATCATAAGTTCCTTCATTCACGAAAGCTCCATGTCCCGGGCACAGTCTCCTCCAG
TG
CCTGCAAGGAAGAACCAACTCCGTGCAGAAGAGGAGAAAAAAAATGTGATTATGGAGTTATCAGAAAT
G
AGGAAGCAGCTCCGGAGCGAGGAGAGGCGTTTGCAGGGGCGGCTGCTGCACCTGGACAGTGACGACGAG
ATC
CCCATGAGGAAAAGAGAGAGGAACCCAATGGATATATTTGACATGGCTAGACATCGGGTACAAGCCC
CT
GTCAGAAGACCATCGCCTAAGGGCTTAGATGCTACTACTTTTCAGAATATTCATGACTTTAATGAGCT
G
AGAGAGAGAGATTCAGATACTCGAGTGGATCTGAGATTAATGTACCCAGATCCTCCCCGCGATCATCAC
ACC
TTGGAGATTCAGCAGCAGGCCCTACTCCGAGAGCAGCAGAAGAGGCTTAATAGAATAAAGATGCGGA
GA
GATGCAGGAGCTGATTTGGACACCATCTGCACTGATAATGCACAAGGGCGCAGAATGCCCAGAGATGA
C
ACTAATGATTTTTTGAAAAATTCATTACTAGAATCTGATAGTGCTTTTATTGGTGCTTATGGTGAGACA
TAT
CCTGTTATTGAAGACAATGCCTTCCCTCCACCATCACAGCTGCCCTCTGCAAGGGAACGCAGGAGGA
AC
AAATTAAAAGGACTAGATTTTGACAGTAGTCGGCTGCACACCCCACAAGATGGTCTCTCTTTAAAATC
T
ATCTCCAGTGTAAATGTCGATCAAGTTAGAATGAGAAATGAAGACAGAATGAGAAGACTGACTGAGCAG
CAG
AAGAAACCCACTAACACAGATGATGAGGGTTCACTGGTTGATCCTGATGACATCATGAGACACCTGA
GT
GATGATGGACGCAACTCTGCGGCAACTGAGCCCTGGCTCCGCCCTGGCACTTCAGAAAGTCTGAAACG
G
TTCATGGCAGAGCATCTGAATGAAGAACAGCATAAGGGGCCTGGGAAGCCAGGCACGTTTACTTGGCAG
GGC
CTCTCTGCTGCACATGCTTAA


Translation (1197 aa):
MADSLDEFIEEQKAKLAKDKAELESDPPYMEMKGKASEKLSENSKILISMAKENIPPSSQQQPKGPLGIE
Y
GLSLPLGEDYEQKKHKLKEELRQDYRRYLTQ
KNFLSTGETDPSTLGVSLPIDERLSAKERLKLERNREY
N
QFLRGKAESTEKVRQVEKNIE
PKSQRNKNPISQGKSDLPLQIQTAYTHSEGPWLSRQEEGLYRQLDGEI
E
LRSRRPLKQTKEEVGISGAEHPSLSGSAGVPERRARRANGERVLDRQHCRADRDPGVSEDMDERFRFES
D
FDRRLLRVYTNG
RPHGSRRGYVDGDDVPEEPNTQISAAENKSVHCNGPPRSADLDITSPFAGMLFGGED
R
ELTKRRKEKYRQELLEQIAEQQKKKR
REKDLAFGITTSGVQDPEKSPDRLKQFSLTPRHFEEMPPERPR
V
AFQTPPPPFSAPSSPSVPPVHSAPSHNEDLHSGLGSTLGELAHP
RVLPVPLNPPPPPLLAPPASNYRTP
Y
DDAYYFYGARNTLDPNIVY
YGSGMIGGQPAPHVSAPVTHQVAPPAVNTVGQNEQKVLSDGLRNSGLVFE
D
KPKPSTQSLQSYQEALQEQ
IREREARRKKERLEKEEYEAKLEAEMRIYNPWGKGGGGAPLRDAKGNLIT
D
LNRMHRQNIDAYHNPDARTYEDKRAVVSIDQNLATSNAENLEDSANKNS
GPLQTQSSPFARGNTFGEPL
S
ELQIKQQELYKNFLRFQ
IEEKRQREEAEREKLRVAEEKEEKRLAEQRARIQQEYEEEQERRREKEEEQR
L
KNEELIRLAEERRKEAERKKKEEEEKHNLQLQHYYERENIIGDETK
HLRQPSPVVPALQNKIASKLQRP
P
SVDTIISSFIH
ESSMSRAQSPPVPARKNQLRAEEEKKNVIMELSEMRKQLRSEERRLQGRLLHLDSDDE
I
PM
RKRERNPMDIFDMARHRVQAPVRRPSPKGLDATTFQNIHDFNELRERDSDTRVDLRLMYPDPPRDHH
T
LEIQQQALLREQQKRLNRIKMRRDAG
ADLDTICTDNAQGRRMPRDDTNDFLKNSLLESDSAFIGAYGET
Y
PVIEDNAFPPPSQLPSARERRRNKLKGLDF
DSSRLHTPQDGLSLKSISSVNVDQVRMRNEDRMRRLTEQ
Q
KKPTNT
DDEGSLVDPDDIMRHLSDDGRNSAATEPWLRPGTSESLKRFMAEHLNEEQHKGPGKPGTFTWQ
G
LSAAHA




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser