NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS35507.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
35507.1 Public Mus musculus 1 Rb1cc1 21 106 86 CCDS HistoryNCBI Gene:12421Re-query CCDS DB by CCDS ID:35507.1Re-query CCDS DB by GeneID:12421See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 35507.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000027040 ENSMUSP00000027040 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000027040Link to Ensembl Protein Viewer:ENSMUSP00000027040Re-query CCDS DB by Nucleotide ID:ENSMUST00000027040Re-query CCDS DB by Protein ID:ENSMUSP00000027040
Original member Current member EBI,WTSI OTTMUST00000084091 OTTMUSP00000045266 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000084091Link to Vega Protein Viewer:OTTMUSP00000045266Re-query CCDS DB by Nucleotide ID:OTTMUST00000084091Re-query CCDS DB by Protein ID:OTTMUSP00000045266
Original member Current member NCBI NM_009826.4 NP_033956.2 Accepted alive Link to Nucleotide Sequence:NM_009826.4Link to Protein Sequence:NP_033956.2Re-query CCDS DB by Nucleotide ID:NM_009826Re-query CCDS DB by Protein ID:NP_033956Link to BLAST:NP_033956.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_033956.2 1588 Q9ESK9 1588 100% 0 0

Chromosomal Locations for CCDS 35507.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 1 (NC_000067.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 6230003 6230073 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 6233961 6234087 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 6234229 6234399 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 6238262 6238464 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 6239952 6240378 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 6244105 6244275 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 6244795 6244979 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 6245158 6245344 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 6245425 6245506 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 6245598 6245659 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 6247706 6247809 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 6248066 6248192 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 6248276 6250167 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 6260930 6261095 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 6262834 6262942 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 6263024 6263264 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 6264542 6264590 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 6265574 6265621 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 6268698 6268756 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 6270691 6270827 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 6272701 6272771 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 6274198 6274275 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (4767 nt):
ATGAAGTTATATGTGTTTCTGGTTAACACCGGAACCACGCTGACATTTGACACTGAGCTAACTGTGCAAA
C
T
GTGGCTGATCTTAAGCATGCCATTCAAAGCAAATACAAGATTGCTATTCAGCACCAGGTTCTGGTGGT
C
AATGGAGGAGAATGCATGGCTGCAGATCGAAGAGTGTGTACTTACAGCGCTGGGACGGACACAAATCCA
ATT
TTTCTTTTTAATAAAGAAATGATCTTATGTGACCGTGCACCTGCTATTCCTAAAGCTACCTTTTCAA
CA
GAAAATGACATGGAAATAAAAGTTGAAGAGTCTCTTATGATGCCTGCAGTTTTCCACACTGTTGCTTC
A
AGGACACAGCTTGCAGTGGAAATGTATGACGTTGCCAAGAAGCTCTGCTCTTTCTGTGAAGGGCTTGTC
CAT
GATGAACATCTTCAGCACCAAGGCTGGGCTGCAATCATGGCCAATCTGGAGGACTGTTCAAATTCAT
AC
CAAAAACTTCTTTTCAAGTTTGAAAGTATTTATTCTGATTATCTTCAATCCATAGAAGACATCAAGTT
A
AAACTTACTCATTTAGGAACTGCTGTTTCAGTAATGGCCAAGATTCCACTATTGGAGTGCCTAACCAGA
CAT
AGTTACAGGGAATGTTTGGGAAGACCGGATTCTTTGAATGAACATGAAGGCTCAGAGAAAGCTGAGA
TG
AAAAGATCTACTGAACTGGTGCTCTCTCCTGATATGCCTAGAACAACGAACACATCCTTGGTAACCTC
A
TTTCACAAGTCAATGGAGCATGTAGCTCCAGATCCCACCGGTACTGAACGTGGCAAAGAACTTAGGGAA
TCT
TGTCAAAGTACTGTCCAGCAAGAAGAAGCTTCAGTGGATGCTAAAGACAGTGATCTGCCTTTTTTTA
AT
GTTTCTTTGTTAGACTGGATAAATGTTCAAGATAGACCCAATGATGTGGAATCTCTGGTCAGGAAGTG
C
TTTGATTCTATGAGCAGGCTTGACCCAAAGATTATTCAACCATTTATGTTAGAATGCCATCAAACTATT
GCC
AAACTTGATAATCAGAATATGAAAGCCATTAAAGGGCTTGAAGATCGGCTGTATGCCTTGGACCAGA
TG
ATTGCTAGCTGTAGCCGGCTGGTAAATGAACAGAAAGAGCTTGCTCAGGGATTTTTAGCTAATCAGAT
G
AGAGCTGAAAACTTGAAGGATGCATCTGTGTTACCTGATCTGTGTCTGAGTCATGCAAATCAACTAATG
ATT
ATGTTGCAAAACCACAGAAAACTGTTGGATATTAAACAGAAGTGCACCACTGCCAAACAAGAGCTAG
CA
AACAATCTCCACGTCAGACTGAAGTGGTGTTGTTTTGTGATGCTTCATGCTGATCAAGATGGAGAAAA
A
CTGCAGGCACTGCTCCGCCTTGTAATAGAGCTGTTAGAAAGAGTCAGAATTGTTGAGGCTCTTAGTACA
GTT
CCTCAGATGTATTGCCTAGCTGTTGTTGAGGTTGTAAGAAGAAAAATGTTCATTAAACACTACAGAG
AG
TGGGCTGGTGCTTTAGTCAAAGACGGAAAACAACTATATGAAGCTGAAAAGTCAAAAAGGGAATCCTT
T
GGGAAATTATTTAGGAAGTCCTTTTTAAGAAATCGTCTGTTTAAAGGACTGGACTCCTGGCCTTCCTCA
TTT
TGTACTCAGAAGCCTCGAAAATTTGACTGTGAACTTCCAGATATATCATTAAAAGATTTACAGTTTC
TT
CAATCATTTTGTCCTTCAGAAGTGCAGCCATTCCTCAGGGTCCCCTTACTTTGTGACTTTGAACCTCT
A
CACCAGCATGTACTTGCCCTACATAATTTGGTAAAAGCAGCACAAAGTTTGGATGAAATGTCACAGACT
ATT
ACAGATCTCCTAAATGAACAAAAGGTATCCACAAGTCAGGCATCCCCACAGTCAGCTGCTTCTCCAA
GA
ATAGAAAGTACAACAGGCATTACAACCACTACCTCACCAAAAACTCCTCCTCCACTAACTGTTCAGGA
C
ACCTTATGTCCGGCAGTGTGTCCCTTAGAAGAATTATCTCCAGATAGTATCGATGCTCATACATTTGAT
TTC
GAAACCATCTCCCATCCAAACACAGAACAACCTGTTCACCAAGCTTCTATAGACTTGGATTCATTAG
CA
GAAAGCCCTGAGTCTGACTTTATGTCTGCTGTGAATGAGTTTGTGATAGAAGAAAATTTATCGTCTCC
A
AACCCTATAAGTGATCCACAAAGTCCAGAAATGATGGTGGAGTCACTTTACTCTTCAGTCATCAATGCA
ATA
GATAGTAGGCGTATGCAAGACACAAGTACACGTGGAAACGAGGGCTTTGGGGATCGGGCTGCTCTAC
AT
GTCCAGCTGGAGAAATGCAGAGCTGCTGCACAAGACTCTCACAGCAGTATACAAACCATCAAGGACGA
T
CTGTGCCATTTCAGAACATTTGTACAAAAAGAACAGTGTGACTTAGCAAATTATTTAAAATGTACAGCT
GTA
GAAATAAGAAATATTATTGAAAAAGTAAAATGTTCTCTAGAAATAACACTAAAGGAAAAGCATCAGC
AA
GAACTCCAATCTTTAAAAATTGAGTATGAATGTAAACTTGATGCTCTAGTAAAAGACAGTGAAGAAAA
T
GTAAATAAAATTTTAAAATTGAAAGAAAATTTAGTATCCCTTGAAGAGGCTTTACAAAATAAAGACAAT
GAA
TTCACTTCGATTAAACATGAAAAGGATGCTATTGTCTGTGTGCAGCAAGAAAAGGATCAGAAGTTGT
TA
GAGATGGAAAAGATAATGCATACTCAACATTGTGAAATTAAAGAACTGAAGCAGTCACGAGAGATGGC
A
TTAGAAGACCTGAAAAAGCTGCATGATGAAAAAATCGAGTCATTGAGAGCTGAATTTCAGTGCTTAGAA
CAA
AATCACCTGAAGGAATTAGAGGACACACTGCACATCAGGCACACACAGGAGTTTGAGAAAGTTATGA
CA
GACCACAATATGTCTTTGGAGAAATTAAAAAAAGAAAATCAGCAAAGAATTGACCAGATGCTAGAATC
T
CATGCCTCAACTATTCAGGAAAAAGAGCAACAGCTGCAGGAGTTGAAACTCAAAGTTTCTGACTTGTCA
GAC
ATGAGATGTAAGTTAGAGGTTGAACTTGCACTAAAGGAAGCAGAAACAGATGAGATAAAGATCTTGT
TG
GAAGAGAGCAGAACACAGCAGAAGGAAATGCTGAAGTCTTTACTTGAACAAGAGACCGAAAACTTAAG
A
ACAGAAATAAGTAAACTAAACCAAAAAATTCATGATAATAATGAGAGTTACCAGGTGGGTTTGTCAGAG
TTA
AGAGCTTTAATGACAATTGAAAAAGATCAGTGCATTTCAGAGTTAATCAGTAGACATGAAGAAGAAT
CT
AATATACTTAAGGCTGAATTAGACAATGTTACATCTTTGCATCGCCAAGCATATGAAATAGAAAAAAA
A
CTGAAAGAACAAATAGTTGAATTGCAGACTAGATTGAACTCAGAATTGAGTGCTCTTGAAAAACAGAAA
GAT
GAAAAAATAACCCAACAAGAAGAGAAGTATGAAGCACTTATCCAGAACCTTGAGAAAGACAAGGAGA
GA
CTGGTCAAGAACCACGAGCAAGACAAAGAACACTTAATTCAGGAGCTTAATTTTGAAAAAAACAAAGC
T
GTTCAAACTGCACTAGATGAATTTAAGGTGGAGAGAGAACTTGTTGAGAAAGAGTTATTAGAAAAAGTT
AAA
CATCTTGAGAATCAAATAGCCAAAACTCCTGCCTTTGAGTCAGCCAGAGAAGATTCTTCAAGCTTAG
TT
GCGGAACTTCAAGAGAAACTTCAAGAAGAAAAAGCTAAGTTTCTGGAACAACTTGAAGAACAAGAGAA
A
AGAAAGAATGAGGAAATGCAAAATGTCAGAACCTCTTTGATTGCTGAGCAGCAGACCAACTTTAACACA
GTC
TTAACAAGAGAGAAAATGAGGAAAGAAAACATAATAAATGATCTTAGTGATAAGCTAAAAAGTACAA
TG
CAGCAGCAAGAGCGGGATAAAGATTTGATAGAGTCGCTCTCTGAGGACCGAGCTCGTTTGCTTGAAGA
G
AAGAAGCAGCTTGAAGAGGAAGTGAGTAAACTCCGCACTAGCAGTTTTCTTTCCTCAGCACCTGTGGCT
GCA
GCCCCAGAGCTCTATGGTGCGTGTGCACCTGAGCTCCCAGGGGAGCCAGAGAGATCAGTCATGGAGA
CG
GCAGATGAAGGAAGACTGGATTCCGCAATGGAGACAAGCATGATGTCTGTCCAAGAAAACATGTTATC
T
GAAGAGAAGCAGAGGATCATGCTCCTAGAACGGACATTGCAGTTGAAAGAAGAAGAAAACAAGCGGTTA
AAT
CAAAGACTGATGTCTCAGAGTTTGTCCTCAGTCTCTTCAAGGCATTCTGAAAAAATAGCCATTAGAG
A
T
TTTCAGGTGGGAGATTTGGTTCTCATCATCCTAGATGAGCGGCACGACAATTATGTATTGTTTACTGT
T
AGTCCTACTTTATATTTTCTGCACTCAGAGTCTCTTCCTGCCCTGGATCTCAAACCAGGTGAGGGAGCT
TCA
GGTGCATCTAGAAGACCCTGGGTCCTTGGGAAAGTAATGGAAAAGGAATACTGTCAAGCCAAAAAGG
CA
CAAAACAGATTTAAAGTTCCTTTGGGGACAAAGTTTTACAGAGTGAAAGCTGTGTCATGGAATAAGAA
A
GTATAG


Translation (1588 aa):
MKLYVFLVNTGTTLTFDTELTVQTVADLKHAIQSKYKIAIQHQVLVVNGGECMAADRRVCTYSAGTDTNP
I
FLFNKEMILCDRAPAIPKATFSTENDMEIKVEESLMMPAVFHTVASRTQLAV
EMYDVAKKLCSFCEGLV
H
DEHLQHQGWAAIMANLEDCSNSYQKLLFKFESIYSDYLQSIEDIKLKLT
HLGTAVSVMAKIPLLECLTR
H
SYRECLGRPDSLNEHEGSEKAEMKRSTELVLSPDMPRTTNTSLVTSFHKSMEHVAPDPTGTERGKELRE
S
CQSTVQQEEASVDAKDSDLPFFNVSLLDWINVQDRPNDVESLVRKCFDSMSR
LDPKIIQPFMLECHQTI
A
KLDNQNMKAIKGLEDRLYALDQMIASCSRLVNEQKELAQ
GFLANQMRAENLKDASVLPDLCLSHANQLM
I
MLQNHRKLLDIKQKCTTAKQELANNLHVRL
KWCCFVMLHADQDGEKLQALLRLVIELLERVRIVEALST
V
PQMYCLAVVEVVRRKMFIKHYRE
WAGALVKDGKQLYEAEKSKRESFGKLFRKSFLRNRLFKGLDSWPSS
F
C
TQKPRKFDCELPDISLKDLQFLQSFCPSEVQPFLRVPLLCDFEPLHQHVLALHNLVKAAQSLDEMSQT
I
TDLLNEQK
VSTSQASPQSAASPRIESTTGITTTTSPKTPPPLTVQDTLCPAVCPLEELSPDSIDAHTFD
F
ETISHPNTEQPVHQASIDLDSLAESPESDFMSAVNEFVIEENLSSPNPISDPQSPEMMVESLYSSVINA
I
DSRRMQDTSTRGNEGFGDRAALHVQLEKCRAAAQDSHSSIQTIKDDLCHFRTFVQKEQCDLANYLKCTA
V
EIRNIIEKVKCSLEITLKEKHQQELQSLKIEYECKLDALVKDSEENVNKILKLKENLVSLEEALQNKDN
E
FTSIKHEKDAIVCVQQEKDQKLLEMEKIMHTQHCEIKELKQSREMALEDLKKLHDEKIESLRAEFQCLE
Q
NHLKELEDTLHIRHTQEFEKVMTDHNMSLEKLKKENQQRIDQMLESHASTIQEKEQQLQELKLKVSDLS
D
MRCKLEVELALKEAETDEIKILLEESRTQQKEMLKSLLEQETENLRTEISKLNQKIHDNNESYQVGLSE
L
RALMTIEKDQCISELISRHEEESNILKAELDNVTSLHRQAYEIEKKLKEQIVELQTRLNSELSALEKQK
D
EKITQQEEKYEALIQNLEKDKERLVKNHEQDKEHLIQELNFEKNKAVQTALDEFKVERELVEKELLEKV
K
HLENQIAK
TPAFESAREDSSSLVAELQEKLQEEKAKFLEQLEEQEKRKNEEMQNVRTSLIAEQQTNFNT
V
LTREKMRKENIINDLSDKLKSTMQQQERDK
DLIESLSEDRARLLEEKKQLEEEVSKLRTSSFLSSAPVA
A
APELYGACAPELPGEPERSVMETADEGRLDSAMETSMMSV
QENMLSEEKQRIMLLERTLQLKEEENKRL
N
QRL
MSQSLSSVSSRHSEKIAIRDFQVGDLVLIILDERHDNYVLFTVSPTLYFLHSESLPALDLKPGEGA
S
GASRRPWVLGKVMEKEYCQAKK
AQNRFKVPLGTKFYRVKAVSWNKKV



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser