NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS34525.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
34525.1 Public Homo sapiens 6 CLVS2 24 110 108 CCDS HistoryNCBI Gene:134829Re-query CCDS DB by CCDS ID:34525.1Re-query CCDS DB by GeneID:134829See the combined annotation on chromosome 6 in Sequence Viewer

Public since: CCDS release 3, NCBI annotation release 36.2, Ensembl annotation release 41

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 34525.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000275162.10 ENSP00000275162.4 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000275162.10Link to Ensembl Protein Viewer:ENSP00000275162.4Re-query CCDS DB by Nucleotide ID:ENST00000275162Re-query CCDS DB by Protein ID:ENSP00000275162
Original member Current member NCBI NM_001010852.4 NP_001010852.2 MANE Select Accepted alive Link to Nucleotide Sequence:NM_001010852.4Link to Protein Sequence:NP_001010852.2Re-query CCDS DB by Nucleotide ID:NM_001010852Re-query CCDS DB by Protein ID:NP_001010852Link to BLAST:NP_001010852.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001010852.2 327 Q5SYC1-1 327 100% 0 0

Chromosomal Locations for CCDS 34525.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '+' strand of Chromosome 6 (NC_000006.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6See the combined annotation on chromosome 6 in Sequence Viewer

Chromosome Start Stop Links
6 122997778 122998166 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 123010985 123011159 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 123048622 123048732 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 123055806 123056026 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 123063674 123063761 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (984 nt):
ATGACTCATTTGCAAGCCGGTCTCTCCCCTGAGACCCTGGAGAAAGCTCGCCTGGAGCTCAATGAAAACC
CA
GACACGCTGCACCAGGACATCCAGGAGGTGAGGGATATGGTCATCACCAGGCCGGACATTGGCTTTCT
G
CGCACGGATGATGCCTTCATCTTACGCTTCTTGCGGGCTAGGAAGTTTCATCACTTTGAGGCCTTCCGC
CTC
CTGGCGCAGTACTTTGAGTACCGGCAGCAGAACCTGGACATGTTCAAAAGCTTTAAGGCCACCGACC
CT
GGCATCAAGCAGGCACTGAAGGATGGCTTCCCTGGGGGCCTGGCCAATCTGGACCACTATGGCAGGAA
G
ATTCTAGTCCTTTTTGCTGCCAATTGGGATCAGAGCAGGTACACACTGGTGGATATTTTGCGTGCCATC
TTA
CTTTCTTTAGAAGCCATGATTGAAGATCCTGAGCTTCAAGTGAATGGGTTTGTTTTGATCATAGACT
GG
AGTAACTTCACTTTCAAGCAAGCCTCTAAACTCACACCAAGTATGCTGCGATTAGCTATTGAAGGCCT
G
CAGGATAGTTTCCCAGCGCGATTTGGAGGAATTCATTTTGTCAATCAACCATGGTATATCCATGCCCTG
TAC
ACCGTGATCCGGCCTTTCCTGAAGGAGAAAACTCGGAAAAGGATATTTTTGCATGGTAACAACCTGA
AC
AGTCTACACCAACTAATTCATCCTGAGATCCTGCCCTCTGAGTTTGGAGGAATGCTGCCTCCTTATGA
C
ATGGGGACATGGGCAAGAACACTGCTAGACCATGAATATGACGATGACAGCGAGTACAATGTAGACTCC
TAC
AGCATGCCTGTGAAGGAAGTAGAGAAGGAACTCTCCCCAAAGTCCATGAAGAGATCTCAATCAGTAG
TG
GATCCTACAGTACTAAAACGCATGGATAAAAATGAGGAAGAAAACATGCAACCATTGCTTTCTCTGGA
C
TAA


Translation (327 aa):
MTHLQAGLSPETLEKARLELNENPDTLHQDIQEVRDMVITRPDIGFLRTDDAFILRFLRARKFHHFEAFR
L
LAQYFEYRQQNLDMFKSFKATDPGIKQALKDGFPGGLANLDHYGRKILVLFAANWDQS
RYTLVDILRAI
L
LSLEAMIEDPELQVNGFVLIIDWSNFTFKQASKLTPSMLRLAIEGLQ
DSFPARFGGIHFVNQPWYIHAL
Y
TVIRPFLKEKTRKR
IFLHGNNLNSLHQLIHPEILPSEFGGMLPPYDMGTWARTLLDHEYDDDSEYNVDS
Y
SMPVKEVEKELSPKSMK
RSQSVVDPTVLKRMDKNEEENMQPLLSLD



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser