NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS34324.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
34324.1 Public Homo sapiens 5 RACK1 22 109 92 CCDS HistoryNCBI Gene:10399Re-query CCDS DB by CCDS ID:34324.1Re-query CCDS DB by GeneID:10399See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 3, NCBI annotation release 36.2, Ensembl annotation release 41

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 34324.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000512805.5 ENSP00000426909.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000512805.5Link to Ensembl Protein Viewer:ENSP00000426909.1Re-query CCDS DB by Nucleotide ID:ENST00000512805Re-query CCDS DB by Protein ID:ENSP00000426909
Original member NCBI NM_006098.4 NP_006089.1 Updated not alive Link to Nucleotide Sequence:NM_006098.4Link to Protein Sequence:NP_006089.1Re-query CCDS DB by Nucleotide ID:NM_006098Re-query CCDS DB by Protein ID:NP_006089
Current member NCBI NM_006098.5 NP_006089.1 Accepted alive Link to Nucleotide Sequence:NM_006098.5Link to Protein Sequence:NP_006089.1Re-query CCDS DB by Nucleotide ID:NM_006098Re-query CCDS DB by Protein ID:NP_006089Link to BLAST:NP_006089.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_006089.1 317 P63244 317 100% 0 0

Chromosomal Locations for CCDS 34324.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 5 (NC_000005.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 181236977 181237042 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 181237609 181237719 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 181238099 181238239 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 181239067 181239177 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 181239487 181239582 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 181241492 181241639 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 181242174 181242345 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 181243692 181243800 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (954 nt):
ATGACTGAGCAGATGACCCTTCGTGGCACCCTCAAGGGCCACAACGGCTGGGTAACCCAGATCGCTACTA
CC
CCGCAGTTCCCGGACATGATCCTCTCCGCCTCTCGAGATAAGACCATCATCATGTGGAAACTGACCAG
G
GATGAGACCAACTATGGAATTCCACAGCGTGCTCTGCGGGGTCACTCCCACTTTGTTAGTGATGTGGTT
ATC
TCCTCAGATGGCCAGTTTGCCCTCTCAGGCTCCTGGGATGGAACCCTGCGCCTCTGGGATCTCACAA
C
G
GGCACCACCACGAGGCGATTTGTGGGCCATACCAAGGATGTGCTGAGTGTGGCCTTCTCCTCTGACAA
C
CGGCAGATTGTCTCTGGATCTCGAGATAAAACCATCAAGCTATGGAATACCCTGGGTGTGTGCAAATAC
ACT
GTCCAGGATGAGAGCCACTCAGAGTGGGTGTCTTGTGTCCGCTTCTCGCCCAACAGCAGCAACCCTA
TC
ATCGTCTCCTGTGGCTGGGACAAGCTGGTCAAGGTATGGAACCTGGCTAACTGCAAGCTGAAGACCAA
C
CACATTGGCCACACAGGCTATCTGAACACGGTGACTGTCTCTCCAGATGGATCCCTCTGTGCTTCTGGA
GGC
AAGGATGGCCAGGCCATGTTATGGGATCTCAACGAAGGCAAACACCTTTACACGCTAGATGGTGGGG
AC
ATCATCAACGCCCTGTGCTTCAGCCCTAACCGCTACTGGCTGTGTGCTGCCACAGGCCCCAGCATCAA
G
ATCTGGGATTTAGAGGGAAAGATCATTGTAGATGAACTGAAGCAAGAAGTTATCAGTACCAGCAGCAAG
GCA
GAACCACCCCAGTGCACCTCCCTGGCCTGGTCTGCTGATGGCCAGACTCTGTTTGCTGGCTACACGG
AC
AACCTGGTGCGAGTGTGGCAGGTGACCATTGGCACACGCTAG


Translation (317 aa):
MTEQMTLRGTLKGHNGWVTQIATTPQFPDMILSASRDKTIIMWKLTRDETNYGIPQRALRGHSHFVSDVV
I
SSDGQFALSGSWDGTLRLWDLT
TGTTTRRFVGHTKDVLSVAFSSDNRQIVSGSRDKTIKLWNTLGVCKY
T
VQ
DESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLNTVTVSPDGSLCASG
G
K
DGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGKIIVDELKQEVISTSSK
A
EPPQCTSLAWSADGQ
TLFAGYTDNLVRVWQVTIGTR



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser