NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS34287.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
34287.1 Public Homo sapiens 5 RANBP17 22 109 92 CCDS HistoryNCBI Gene:64901Re-query CCDS DB by CCDS ID:34287.1Re-query CCDS DB by GeneID:64901See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 3, NCBI annotation release 36.2, Ensembl annotation release 41

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 34287.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000523189.5 ENSP00000427975.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000523189.5Link to Ensembl Protein Viewer:ENSP00000427975.1Re-query CCDS DB by Nucleotide ID:ENST00000523189Re-query CCDS DB by Protein ID:ENSP00000427975
Original member NCBI NM_022897.4 NP_075048.1 Updated not alive Link to Nucleotide Sequence:NM_022897.4Link to Protein Sequence:NP_075048.1Re-query CCDS DB by Nucleotide ID:NM_022897Re-query CCDS DB by Protein ID:NP_075048
Current member NCBI NM_022897.5 NP_075048.1 Accepted alive Link to Nucleotide Sequence:NM_022897.5Link to Protein Sequence:NP_075048.1Re-query CCDS DB by Nucleotide ID:NM_022897Re-query CCDS DB by Protein ID:NP_075048Link to BLAST:NP_075048.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_075048.1 1088 Q9H2T7-1 1088 100% 0 0

Chromosomal Locations for CCDS 34287.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 5 (NC_000005.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 170862034 170862051 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 170878097 170878243 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 170881806 170881896 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 170892387 170892553 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 170896050 170896115 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 170909661 170909765 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 170910969 170911134 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 170914167 170914240 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 170916465 170916584 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 170918713 170918859 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 170919441 170919613 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 170924357 170924550 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 170953597 170953702 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 170968242 170968377 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 171170130 171170203 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 171171206 171171286 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 171183167 171183230 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 171183322 171183430 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 171199670 171199773 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 171205524 171205612 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 171213631 171213738 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 171221758 171221840 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 171240928 171241142 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 171242682 171242820 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 171265681 171265847 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 171293883 171293981 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 171295887 171296014 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 171298762 171298858 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3267 nt):
ATGGCGCTGCACTTCCAGAGTTTGGCTGAATTGGAAGTGTTATGTACTCATCTCTACATAGGGACTGATC
TT
ACACAAAGAATAGAGGCTGAGAAAGCACTCTTGGAACTTATTGACAGTCCAGAATGTCTCAGCAAGTG
T
CAACTTTTATTAGAACAAGGAACAACATCCTATGCTCAGCTCCTTGCAGCAACATGTCTTTCAAAACTT
GTC
AGCCGAGTCAGTCCTTTACCTGTTGAGCAGAGGATGGACATCAGAAACTACATTCTGAATTACGTGG
CA
TCACAGCCCAAGCTGGCTCCCTTTGTCATCCAAGCTCTTATTCAAGTCATTGCTAAAATCACTAAGTT
G
GGGTGGTTTGAGGTTCAGAAAGACCAATTTGTCTTCAGAGAAATTATTGCTGATGTGAAGAAGTTTCTC
CAG
GGTACTGTGGAACACTGCATAATAGGAGTAATAATCCTTTCTGAATTGACTCAGGAAATGAACCTGG
TT
GATTATTCTAGACCTTCAGCAAAACACAGGAAAATAGCTACCTCATTTCGTGATACTTCTCTCAAAGA
C
GTTTTAGTGCTAGCATGCTCTCTTTTAAAAGAGGTGTTTGCCAAACCTTTAAATCTTCAGGATCAATGT
CAG
CAAAATCTGGTAATGCAGGTCTTGAAACTGGTCCTTAACTGCCTTAACTTTGACTTCATTGGCAGTT
CA
GCAGATGAATCTGCAGATGATCTTTGCACGGTGCAGATTCCAACAACTTGGAGAACAATTTTCCTGGA
A
CCAGAAACATTGGATCTTTTCTTCAATTTGTATCATTCACTTCCACCACTACTATCTCAGTTAGCACTT
TCA
TGTTTAGTTCAGTTTGCTTCGACAAGAAGGTCCTTATTTAACAGTCCTGAACGTGCCAAGTACCTTG
GT
AATTTAATTAAGGGAGTAAAAAGGATACTTGAAAACCCTCAGGGTTTGTCTGATCCAGGTAATTATCA
T
GAATTTTGTCGATTTTTGGCTCGTTTAAAGACAAATTATCAGCTGGGAGAATTAGTTATGGTGAAGGAA
TAT
CCTGAAGTTATTAGATTGATTGCTAATTTTACCATTACTAGCCTACAGCACTGGGAATTTGCTCCTA
AC
AGTGTTCATTATTTATTAACTCTGTGGCAAAGGATGGTAGCATCTGTTCCTTTTGTGAAATCAACTGA
A
CCCCACCTATTAGACACTTATGCACCAGAAATCACGAAGGCCTTTATCACTTCTCGGTTGGACTCTGTT
GCC
ATAGTTGTGAGAGATCACTTAGATGATCCACTGGATGATACTGCCACTGTGTTTCAGCAGTTGGAGC
AG
TTGTGCACGGTCAGCAGATGTGAATATGAAAAGACATGTGCTCTTCTTGTGCAGTTATTCGACCAAAA
T
GCACAGAATTACCAAAAACTTCTGCATCCATATTCTGGTGTAACTGTGGACATCACCATTCAGGAAGGA
CGT
CTTGCATGGCTGGTATACTTAGTTGGGACAGTTGTAGGAGGAAGATTAACATATACCAGTACAGATG
AG
CATGATGCTATGGATGGAGAATTATCCTGTCGAGTTTTTCAGCTTATATCTTTAATGGATACCGGATT
G
CCTCGATGTTGTAATGAGAAAATAGAGCTTGCAATTCTGTGGTTCTTGGATCAGTTTCGTAAAACATAT
GTT
GGTGATCAACTTCAAAGAACCTCAAAGGTATATGCTCGTATGTCAGAAGTCTTAGGAATAACAGATG
AC
AACCACGTTCTAGAGACGTTCATGACAAAAATTGTTACAAACCTTAAATACTGGGGAAGATATGAGCC
T
GTAATTTCAAGGACTCTTCAGTTCCTAAATGACCTTTCTGTTGGTTATATCCTTTTAAAAAAACTTGTG
AAG
ATAGATGCTGTGAAATTCATGCTAAAAAACCACACGAGTGAACACTTCCCTTTTCTTGGCATCAGTG
AC
AATCATAGTCTCAGCGACTTCAGGTGTCGAACAACCTTCTACACAGCGCTCACTCGCCTTCTGATGGT
A
GATCTGGGTGAAGATGAGGATGAATTTGAGAATTTCATGCTGCCTCTTACAGTTGCTTTTGAAACAGTA
TTA
CAAATATTCAACAACAACTTTAAACAAGAAGATGTAAAGCGTATGTTGATCGGGCTGGCAAGAGATC
TT
CGAGGGATTGCCTTTGCACTGAACACAAAGACCAGCTACACCATGCTGTTTGACTGGATGTACCCAAC
G
TACCTTCCCCTTCTTCAGAATGCTGTTGAACGGTGGTATGGAGAGCCAACATGTACAACTCCCATCTTG
AAA
CTTATGGCAGAACTTATGCAAAACAGATCCCAGCGTTTGAATTTTGATGTATCATCTCCTAATGGAA
TT
CTTCTCTTCAGAGAAGCTAGTAAAATGGTTTGCACTTATGGTAATCAGATCCTGTCCCTTGGGAGCCT
C
TCAAAAGATCAGATTTATCCAATGAAACTCAAGGGCATCTCCATCTGCTATTCAGCTCTCAAGTCTGCC
TTG
TGTGGAAATTATGTCAGCTTTGGCGTCTTCAAGTTGTATGGGGACAACCATTTTGACAATGTACTCC
AG
GCTTTTGTCAAAATGCTGCTGTCAGTGTCCCACAGTGACTTGCTACAATACCGGAAACTGAGCCAGTC
T
TATTATCCACTCCTGGAATGTCTCACTCAGGACCATATGAGCTTCATCATCAACTTAGAGCCTCCTGTA
CTC
ATGTATGTTCTCACATCTATCTCAGAGGGACTCACTACTCTTGATACAGTTGTCTCCTCCAGCTGCT
GT
ACCAGTTTAGACTACATCGTCACCTACCTCTTCAAGCACATAGCAAAAGAGGGCAAGAAGCCACTTCG
A
TGCAGAGAGGCTACCCAGGCTGGTCAGAGACTATTACATTTTATGCAGCAAAACCCAGATGTCCTGCAG
CAG
ATGATGTCTGTCCTCATGAACACCATTGTCTTTGAAGACTGTCGGAACCAGTGGTCAGTATCCAGGC
CT
CTCCTGGGGCTCATCCTGCTCAATGAGAAGTATTTCAGTGAACTGAGAGCAAGTTTGATAAACAGCCA
G
CCCCTCCCCAAGCAGGAGGTCCTTGCCCAGTGCTTCAGAAACCTAATGGAAGGAGTGGAGCAGAACCTG
TCC
GTCAAGAACAGAGACAGGTTCACCCAAAATCTGTCTGTATTCAGAAGAGATGTGGCAGAGGCGTTGC
GC
AGTGATGGCAACACTGAACCATGCAGTCTCGACATGATGAGCTGA


Translation (1088 aa):
MALHFQSLAELEVLCTHLYIGTDLTQRIEAEKALLELIDSPECLSKCQLLLEQGTTSYAQLLAATCLSKL
V
SRVSPLPVEQRMDI
RNYILNYVASQPKLAPFVIQALIQVIAKITKLGWFEVQKDQFVFREIIADVKKFL
Q
GTVEHCIIGVIILSELTQEMNLVDYSRPSAKHRKIATSFRDTSLKDVLVLACSLLKEVFAKPLNLQDQC
Q
QNLVMQVLKLVLNCLNFDFIGSSADESADDLCTVQIPTTWRT
IFLEPETLDLFFNLYHSLPPLLSQLAL
S
CLVQFASTRRSLFNSPERAKYLGNLIKGVKRILENPQ
GLSDPGNYHEFCRFLARLKTNYQLGELVMVKE
Y
PEVIRLIANFTITSLQ
HWEFAPNSVHYLLTLWQRMVASVPFVKSTEPHLLDTYAPEITKAFITSRLDSV
A
IVV
RDHLDDPLDDTATVFQQLEQLCTVSRCEYEKTCALLVQLFDQNAQNYQKLLHPYSGVTVDITIQEG
R
LAWLVYLVGTVVGGRLTYTSTDEHDAMDGELSC
RVFQLISLMDTGLPRCCNEKIELAILWFLDQFRKTY
V
GDQLQRTSK
VYARMSEVLGITDDNHVLETFMTKIVTNLKYWGRYEPVISRTLQFLNDLSVGYILLKKLV
K
IDAVKFMLKNHT
SEHFPFLGISDNHSLSDFRCRTTFYTALTRLLMVDLGEDEDEFENFMLPLTVAFETV
L
QIFNNNFKQEDVK
RMLIGLARDLRGIAFALNTKTSYTMLFDWMYPTYLPLLQNAVERWYGEPTCTTPIL
K
LMAELMQN
RSQRLNFDVSSPNGILLFREASKMVCTYGNQILSLGSLSKDQIYPMKLKGISICYSALKSA
L
CGNYVSFGVFKLYGDNHFDNVLQAFVKMLLSVSHSDLL
QYRKLSQSYYPLLECLTQDHMSFIINLEPPV
L
MYVLTSISEGLTTL
DTVVSSSCCTSLDYIVTYLFKHIAKEGKKPLRCREATQAGQRLLHFMQQNPDVLQ
Q
MMSVLMNTIVFEDCRNQWSVSRPLLGLILLNEKYFSELRASLINSQPLPKQEVLAQCFRNLMEGVEQNL
S
VKNRD
RFTQNLSVFRRDVAEALRSDGNTEPCSLDMMS



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser