NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS34129.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
34129.1 Public Homo sapiens 5 SLC12A7 22 109 92 CCDS HistoryNCBI Gene:10723Re-query CCDS DB by CCDS ID:34129.1Re-query CCDS DB by GeneID:10723See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 3, NCBI annotation release 36.2, Ensembl annotation release 41

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 34129.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000264930.9 ENSP00000264930.5 Accepted alive Link to Ensembl Transcript Viewer:ENST00000264930.9Link to Ensembl Protein Viewer:ENSP00000264930.5Re-query CCDS DB by Nucleotide ID:ENST00000264930Re-query CCDS DB by Protein ID:ENSP00000264930
Original member NCBI NM_006598.2 NP_006589.2 Updated not alive Link to Nucleotide Sequence:NM_006598.2Link to Protein Sequence:NP_006589.2Re-query CCDS DB by Nucleotide ID:NM_006598Re-query CCDS DB by Protein ID:NP_006589
Current member NCBI NM_006598.3 NP_006589.2 Accepted alive Link to Nucleotide Sequence:NM_006598.3Link to Protein Sequence:NP_006589.2Re-query CCDS DB by Nucleotide ID:NM_006598Re-query CCDS DB by Protein ID:NP_006589Link to BLAST:NP_006589.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_006589.2 1083 Q9Y666-1 1083 100% 0 0

Chromosomal Locations for CCDS 34129.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 5 (NC_000005.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 1052360 1052451 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 1053349 1053482 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 1057471 1057649 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 1060344 1060451 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 1063844 1063975 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 1064083 1064252 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 1065283 1065478 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 1073633 1073801 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 1074567 1074671 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 1075371 1075490 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 1076138 1076236 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 1076694 1076812 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 1077833 1078007 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 1078701 1078758 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 1079398 1079496 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 1081577 1081744 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 1083745 1083956 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 1085232 1085473 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 1086903 1087033 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 1088306 1088360 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 1088982 1089128 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 1093533 1093655 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 1094154 1094248 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 1111868 1111991 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3252 nt):
ATGCCCACCAACTTCACCGTGGTGCCCGTGGAGGCTCACGCCGACGGCGGCGGGGACGAGACTGCCGAGC
GG
ACGGAGGCTCCGGGCACCCCCGAGGGCCCCGAGCCCGAGCGCCCCAGCCCGGGAGATGGAAATCCAAG
A
GAAAACAGCCCATTCCTCAACAATGTCGAGGTGGAACAAGAGAGCTTCTTTGAAGGGAAGAACATGGCA
CTT
TTCGAGGAGGAGATGGACAGTAACCCCATGGTGTCCTCGCTGCTCAACAAGCTGGCCAACTACACCA
AC
CTGAGCCAGGGCGTGGTGGAGCACGAGGAGGACGAGGAGAGCCGGCGGCGGGAGGCCAAGGCTCCGCG
C
ATGGGCACCTTCATCGGCGTCTACCTGCCGTGCCTGCAGAACATCCTGGGCGTCATCCTCTTCCTGCGC
CTG
ACGTGGATCGTGGGGGTGGCTGGTGTCCTGGAGTCCTTCCTCATCGTGGCCATGTGCTGCACATGTA
CA
ATGCTGACCGCCATTTCCATGAGTGCGATCGCTACCAACGGTGTGGTCCCAGCTGGCGGGTCCTACTA
C
ATGATATCGCGCTCGCTGGGACCCGAGTTTGGAGGCGCTGTCGGCCTCTGCTTCTACCTGGGCACGACG
TTT
GCAGGGGCCATGTATATTTTGGGGACCATCGAGATTTTTCTGACGTACATCTCCCCGGGTGCGGCCA
TC
TTCCAGGCGGAGGCTGCAGGTGGCGAGGCGGCCGCCATGCTGCACAACATGCGTGTGTACGGCACGTG
C
ACGCTCGTGCTCATGGCCCTGGTGGTCTTCGTGGGCGTCAAGTATGTCAACAAGCTGGCGCTGGTCTTC
CTG
GCCTGCGTCGTGCTGTCCATCCTGGCCATCTATGCCGGCGTCATCAAGTCTGCCTTCGACCCCCCGG
AC
ATCCCGGTCTGCCTCCTGGGGAACCGCACGCTGTCACGGCGCAGCTTCGATGCCTGCGTCAAGGCCTA
C
GGCATCCACAACAACTCAGCCACCTCCGCGCTCTGGGGCCTCTTCTGCAACGGCTCCCAGCCCAGCGCC
GCC
TGTGACGAGTACTTCATCCAGAACAACGTCACCGAAATCCAGGGCATCCCGGGCGCGGCCAGTGGTG
TC
TTCCTGGAGAACCTGTGGAGTACGTACGCGCACGCGGGGGCGTTTGTGGAGAAGAAAGGTGTGCCCTC
G
GTGCCCGTGGCAGAGGAGAGCCGTGCCAGCGCACTGCCCTACGTGCTCACCGACATCGCGGCCTCCTTC
ACC
CTGCTGGTTGGCATCTACTTCCCTTCCGTGACCGGTATCATGGCGGGTTCAAACCGGTCCGGGGACC
TC
AAGGATGCACAGAAGTCCATCCCCACGGGGACCATCCTGGCCATAGTGACGACGTCTTTCATCTATCT
C
TCCTGCATTGTGCTGTTTGGGGCCTGCATTGAAGGCGTGGTCTTACGAGATAAGTTCGGGGAGGCCCTG
CAG
GGGAACCTGGTCATCGGCATGCTGGCCTGGCCCTCCCCCTGGGTCATCGTCATCGGCTCCTTCTTCT
CC
ACCTGCGGTGCCGGCCTGCAGAGCCTCACGGGGGCACCGCGCCTACTGCAGGCCATTGCCCGTGACGG
C
ATCGTCCCCTTCCTGCAGGTGTTTGGCCACGGGAAGGCCAACGGGGAGCCCACGTGGGCGCTGCTGCTG
ACA
GTCCTCATCTGCGAGACTGGCATCCTCATCGCCTCTCTGGACAGCGTGGCCCCGATCCTCTCCATGT
TC
TTCCTCATGTGCTACCTGTTCGTGAACCTGGCCTGCGCCGTGCAGACCCTGCTACGTACCCCCAACTG
G
CGTCCACGCTTCAAGTTCTACCACTGGACCCTGTCCTTTCTGGGTATGAGCCTGTGCCTGGCGCTGATG
TTC
ATCTGCTCCTGGTACTACGCGCTGTCCGCCATGCTCATCGCTGGCTGCATCTACAAGTACATCGAGT
AC
CGCGGGGCCGAGAAGGAGTGGGGCGATGGCATCCGTGGCCTATCCCTGAACGCCGCCCGCTACGCCCT
G
CTGCGCGTGGAGCACGGTCCCCCCCACACCAAGAACTGGAGGCCCCAGGTGCTGGTGATGCTGAACCTG
GAC
GCGGAGCAGGCCGTGAAGCACCCCCGCCTGCTGTCCTTCACGTCGCAGCTGAAGGCCGGCAAGGGCC
TG
ACCATCGTGGGCTCGGTGCTGGAGGGGACGTACCTGGACAAGCACATGGAGGCTCAGCGGGCCGAGGA
G
AACATACGGTCCCTAATGAGCACAGAGAAGACCAAGGGCTTCTGCCAGCTGGTGGTCTCGTCCAGCCTG
CGG
GATGGCATGTCCCACCTGATCCAGTCGGCCGGCCTGGGCGGCCTGAAGCACAACACGGTGCTCATGG
CC
TGGCCCGCATCCTGGAAGCAGGAGGACAACCCCTTCTCCTGGAAGAACTTTGTGGACACCGTCCGCGA
C
ACCACCGCCGCGCACCAGGCTCTGCTGGTGGCCAAGAACGTCGACTCGTTTCCGCAAAACCAGGAGCGC
TTC
GGCGGGGGCCACATCGACGTGTGGTGGATCGTGCACGACGGCGGCATGCTCATGCTGCTGCCCTTCC
TG
CTGCGCCAGCACAAGGTGTGGAGGAAGTGCCGGATGCGTATCTTCACCGTGGCCCAGGTGGACGACAA
C
AGCATCCAGATGAAGAAGGACCTGCAGATGTTCTTGTACCACTTGCGCATCAGCGCCGAGGTGGAGGTG
GTG
GAGATGGTTGAAAACGACATATCTGCTTTCACCTACGAGAGGACACTAATGATGGAGCAGAGGTCGC
AG
ATGCTGAAGCAGATGCAGCTGTCCAAGAACGAGCAGGAGCGAGAGGCCCAGCTGATCCACGACAGGAA
C
ACCGCGTCCCACACCGCGGCGGCAGCCAGGACCCAAGCGCCGCCTACGCCAGACAAGGTGCAGATGACC
TGG
ACCAGGGAGAAGCTGATCGCTGAGAAGTACAGGAGCAGAGACACCAGCCTATCTGGTTTCAAAGACC
TC
TTCAGCATGAAGCCGGACCAGTCCAACGTCAGGCGGATGCACACGGCTGTGAAGCTCAATGGCGTCGT
C
CTCAACAAGTCCCAGGATGCGCAGCTGGTCCTGCTCAACATGCCAGGTCCTCCCAAAAACCGGCAGGGA
GAC
GAGAACTACATGGAGTTTCTTGAAGTCCTGACCGAGGGGCTGAACAGAGTCCTCCTGGTCAGGGGTG
GC
GGCCGGGAGGTGATCACCATCTACTCCTAA


Translation (1083 aa):
MPTNFTVVPVEAHADGGGDETAERTEAPGTPEGPEPERPSPGDGNPRENSPFLNNVEVEQESFFEGKNMA
L
FE
EEMDSNPMVSSLLNKLANYTNLSQGVVEHEEDEESRRREAKAPRMGTFIGVYLPCLQNILGVILFLR
L
TWIVGVAGVLESFLIVAMCCTC
TMLTAISMSAIATNGVVPAGGSYYMISRSLGPEFGGAVGLCFYLGTT
F
AGAMYILGTIEIFL
TYISPGAAIFQAEAAGGEAAAMLHNMRVYGTCTLVLMALVVFVGVKYVNKLALVF
L
ACVVLSILAIYAGVIKSAFDPPDI
PVCLLGNRTLSRRSFDACVKAYGIHNNSATSALWGLFCNGSQPSA
A
CDEYFIQNNVTEIQGIPGAASGVFL
ENLWSTYAHAGAFVEKKGVPSVPVAEESRASALPYVLTDIAASF
T
LLVGIYFPSVT
GIMAGSNRSGDLKDAQKSIPTGTILAIVTTSFIYLSCIVLFGACIEGVVLRDKFGEAL
Q
GNLVIGMLAWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIARDGIVPFLQ
VFGHGKANGEPTWALLL
T
VLICETGILIASLDSVAPILS
MFFLMCYLFVNLACAVQTLLRTPNWRPRFKFYHWTLSFLGMSLCLALM
F
ICSWYYALSAMLIAGCIYKYIEYR
GAEKEWGDGIRGLSLNAARYALLRVEHGPPHTKNWRPQVLVMLNL
D
AEQAVKHPRLLSFTSQLKAGKGLTIVGSVLEGTYLDKHMEAQRAEE
NIRSLMSTEKTKGFCQLVVSSSL
R
DGMSHLIQSAGLGGLKHNTVLMAWPASWKQEDNPFSWKNFV
DTVRDTTAAHQALLVAKNVDSFPQNQER
F
GGGHIDVWWIVHDGGMLMLLPFLLRQHK
VWRKCRMRIFTVAQVDDNSIQMKKDLQMFLYHLRISAEVEV
V
EM
VENDISAFTYERTLMMEQRSQMLKQMQLSKNEQEREAQLIHDRNTASHTAAAARTQAPPTPDKVQMT
W
TREKLIAEKYRSRDTSLSGFKDLFSMK
PDQSNVRRMHTAVKLNGVVLNKSQDAQLVLLNMPGPPKNRQG
D
EN
YMEFLEVLTEGLNRVLLVRGGGREVITIYS



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser