NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS3391.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
3391.1 Public Homo sapiens 4 S100P 22 109 92 CCDS HistoryNCBI Gene:6286Re-query CCDS DB by CCDS ID:3391.1Re-query CCDS DB by GeneID:6286See the combined annotation on chromosome 4 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 3391.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000296370.3 ENSP00000296370.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000296370.3Link to Ensembl Protein Viewer:ENSP00000296370.3Re-query CCDS DB by Nucleotide ID:ENST00000296370Re-query CCDS DB by Protein ID:ENSP00000296370
Original member NCBI NM_005980.2 NP_005971.1 Updated not alive Link to Nucleotide Sequence:NM_005980.2Link to Protein Sequence:NP_005971.1Re-query CCDS DB by Nucleotide ID:NM_005980Re-query CCDS DB by Protein ID:NP_005971
Current member NCBI NM_005980.3 NP_005971.1 Accepted alive Link to Nucleotide Sequence:NM_005980.3Link to Protein Sequence:NP_005971.1Re-query CCDS DB by Nucleotide ID:NM_005980Re-query CCDS DB by Protein ID:NP_005971Link to BLAST:NP_005971.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_005971.1 95 P25815 95 100% 0 0

Chromosomal Locations for CCDS 3391.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 4 (NC_000004.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4See the combined annotation on chromosome 4 in Sequence Viewer

Chromosome Start Stop Links
4 6693933 6694070 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 6696893 6697042 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (288 nt):
ATGACGGAACTAGAGACAGCCATGGGCATGATCATAGACGTCTTTTCCCGATATTCGGGCAGCGAGGGCA
GC
ACGCAGACCCTGACCAAGGGGGAGCTCAAGGTGCTGATGGAGAAGGAGCTACCAGGCTTCCTGCAGAG
T
GGAAAAGACAAGGATGCCGTGGATAAATTGCTCAAGGACCTGGACGCCAATGGAGATGCCCAGGTGGAC
TTC
AGTGAGTTCATAGTGTTCGTGGCTGCAATCACGTCTGCCTGTCACAAGTACTTTGAGAAGGCAGGAC
TC
AAATGA


Translation (95 aa):
MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVD
F
SEFIVFVAAITSACHKYFEKAGLK




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser