NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS33898.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
33898.1 Public Homo sapiens 3 ABCC5 22 109 92 CCDS HistoryNCBI Gene:10057Re-query CCDS DB by CCDS ID:33898.1Re-query CCDS DB by GeneID:10057See the combined annotation on chromosome 3 in Sequence Viewer

Public since: CCDS release 3, NCBI annotation release 36.2, Ensembl annotation release 41

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 33898.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000382494.6 ENSP00000371934.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000382494.6Link to Ensembl Protein Viewer:ENSP00000371934.2Re-query CCDS DB by Nucleotide ID:ENST00000382494Re-query CCDS DB by Protein ID:ENSP00000371934
Original member NCBI NM_001023587.2 NP_001018881.1 Updated not alive Link to Nucleotide Sequence:NM_001023587.2Link to Protein Sequence:NP_001018881.1Re-query CCDS DB by Nucleotide ID:NM_001023587Re-query CCDS DB by Protein ID:NP_001018881
Current member NCBI NM_001023587.3 NP_001018881.1 Accepted alive Link to Nucleotide Sequence:NM_001023587.3Link to Protein Sequence:NP_001018881.1Re-query CCDS DB by Nucleotide ID:NM_001023587Re-query CCDS DB by Protein ID:NP_001018881Link to BLAST:NP_001018881.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001018881.1 208 O15440-4 208 100% 0 0

Chromosomal Locations for CCDS 33898.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 3 (NC_000003.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3See the combined annotation on chromosome 3 in Sequence Viewer

Chromosome Start Stop Links
3 183985343 183985378 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 183987770 183987917 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 183988572 183988727 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 183989226 183989383 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 184014264 184014392 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (627 nt):
ATGAAGGATATCGACATAGGAAAAGAGTATATCATCCCCAGTCCTGGGTATAGAAGTGTGAGGGAGAGAA
CC
AGCACTTCTGGGACGCACAGAGACCGTGAAGATTCCAAGTTCAGGAGAACTCGACCGTTGGAATGCCA
A
GATGCCTTGGAAACAGCAGCCCGAGCCGAGGGCCTCTCTCTTGATGCCTCCATGCATTCTCAGCTCAGA
ATC
CTGGATGAGGAGCATCCCAAGGGAAAGTACCATCATGGCTTGAGTGCTCTGAAGCCCATCCGGACTA
CT
TCCAAACACCAGCACCCAGTGGACAATGCTGGGCTTTTTTCCTGTATGACTTTTTCGTGGCTTTCTTC
T
CTGGCCCGTGTGGCCCACAAGAAGGGGGAGCTCTCAATGGAAGACGTGTGGTCTCTGTCCAAGCACGAG
TCT
TCTGACGTGAACTGCAGAAGACTAGAGAGACTGTGGCAAGAAGAGCTGAATGAAGTTGGGCCAGACG
CT
GCTTCCCTGCGAAGGGTTGTGTGGATCTTCTGCCGCACCAGGCTCATCCTGTCCATCGTGTGCCTGAT
G
ATCACGCAGCTGGCTGGCTTCAGTGGACCAAATTTTCAGGATGGCTGTATTCTGCGGTCAGAATGA


Translation (208 aa):
MKDIDIGKEYIIPSPGYRSVRERTSTSGTHRDREDSKFRRTRPLECQDALETAARAEGLSLDASMHSQLR
I
LDEEHPKGKYHHGLSALKPIRTTS
KHQHPVDNAGLFSCMTFSWLSSLARVAHKKGELSMEDVWSLSKHE
S
SDVNCR
RLERLWQEELNEVGPDAASLRRVVWIFCRTRLILSIVCLMITQLAGFSGPNFQDGCILRSE



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser