NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS33592.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
33592.1 Public Homo sapiens 21 PCNT 24 110 108 CCDS HistoryNCBI Gene:5116Re-query CCDS DB by CCDS ID:33592.1Re-query CCDS DB by GeneID:5116See the combined annotation on chromosome 21 in Sequence Viewer

Public since: CCDS release 3, NCBI annotation release 36.2, Ensembl annotation release 41

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 33592.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000359568.10 ENSP00000352572.5 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000359568.10Link to Ensembl Protein Viewer:ENSP00000352572.5Re-query CCDS DB by Nucleotide ID:ENST00000359568Re-query CCDS DB by Protein ID:ENSP00000352572
Original member Current member NCBI NM_006031.6 NP_006022.3 MANE Select Accepted alive Link to Nucleotide Sequence:NM_006031.6Link to Protein Sequence:NP_006022.3Re-query CCDS DB by Nucleotide ID:NM_006031Re-query CCDS DB by Protein ID:NP_006022Link to BLAST:NP_006022.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_006022.3 3336 O95613-1 3336 100% 0 0

Chromosomal Locations for CCDS 33592.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '+' strand of Chromosome 21 (NC_000021.9)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21See the combined annotation on chromosome 21 in Sequence Viewer

Chromosome Start Stop Links
21 46324229 46324282 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 46326377 46326589 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 46334397 46334768 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 46346128 46346208 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 46346743 46346998 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 46347457 46347512 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 46349012 46349186 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 46349684 46349820 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 46351429 46351540 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 46353104 46353326 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 46353987 46354068 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 46355452 46355626 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 46356974 46357191 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 46363480 46363934 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 46366584 46367139 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 46381694 46381840 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 46385832 46385983 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 46388742 46388884 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 46389199 46389431 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 46390670 46390832 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 46391164 46391376 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 46397265 46397494 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 46398014 46398130 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 46398235 46398255 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 46399590 46399796 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 46401551 46401721 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 46402331 46402483 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 46411189 46412067 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 46412837 46412992 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 46416069 46416839 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 46418204 46418306 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 46421970 46422124 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 46425831 46425971 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 46427622 46427795 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 46428395 46428590 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 46430010 46430232 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 46430507 46430657 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 46431529 46432215 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 46435904 46436148 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 46436979 46437081 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 46438164 46438337 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 46440083 46440202 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 46440855 46441084 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 46442497 46442573 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 46443810 46443948 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 46444694 46444821 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 46445284 46445327 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (10011 nt):
ATGGAAGTTGAGCAAGAGCAGCGGCGCAGAAAGGTGGAGGCCGGGAGGACGAAGCTTGCTCACTTCCGAC
AG
AGAAAAACAAAAGGTGACAGTTCGCATTCGGAGAAAAAGACGGCGAAGAGGAAGGGCTCGGCTGTCGA
T
GCGTCTGTCCAGGAGGAGAGTCCGGTAACCAAGGAGGACAGCGCACTCTGTGGAGGAGGGGACATTTGC
AAA
AGCACATCATGTGACGACACCCCTGATGGGGCAGGAGGGGCCTTTGCAGCTCAGCCGGAGGACTGTG
AT
GGAGAGAAGAGAGAGGACTTGGAACAGCTGCAGCAGAAGCAAGTCAATGACCATCCTCCAGAGCAGTG
T
GGGATGTTCACAGTCAGTGACCACCCACCAGAACAGCATGGGATGTTCACAGTCGGTGACCACCCACCA
GAA
CAGCGTGGGATGTTCACAGTCAGTGACCACCCACCAGAACAGCATGGGATGTTCACAGTCAGTGACC
AC
CCACCAGAACAGCGTGGGATGTTCACAATCAGTGACCACCAACCGGAACAGCGTGGGATGTTCACAGT
C
AGTGACCACACACCAGAACAGCGTGGGATCTTCACAATCAGTGACCACCCAGCAGAACAGCGTGGGATG
TTC
ACAAAGGAGTGTGAACAAGAATGTGAACTTGCCATTACTGACCTGGAGAGCGGCCGTGAAGATGAGG
CT
GGCCTGCATCAGAGTCAGGCCGTGCATGGCCTTGAGCTGGAGGCGCTGCGCCTGAGTCTGAGCAACAT
G
CACACGGCGCAGCTGGAGCTGACACAGGCCAACCTCCAGAAGGAGAAGGAGACGGCATTGACGGAGCTG
CGG
GAGATGCTCAACAGCCGGCGTGCCCAGGAGCTGGCCCTGCTACAGAGCAGGCAGCAGCACGAGCTGG
AG
CTCCTCAGGGAGCAGCACGCACGGGAGAAGGAGGAGGTGGTGCTCAGGTGTGGACAGGAAGCAGCTGA
G
CTGAAGGAGAAGTTACAATCAGAAATGGAGAAAAACGCCCAGATAGTAAAGACCCTGAAGGAAGATTGG
GAA
TCTGAAAAAGATTTATGTTTAGAAAATCTACGCAAAGAACTGTCTGCAAAGCATCAATCAGAAATGG
AG
GATTTACAAAACCAGTTTCAGAAAGAATTGGCAGAACAGAGAGCTGAGTTGGAGAAGATTTTTCAAGA
C
AAAAACCAGGCTGAACGGGCCCTTAGGAACCTGGAGAGTCATCATCAAGCAGCCATTGAGAAGTTACGT
GAA
GACCTGCAGTCCGAGCACGGCCGGTGTTTAGAAGACTTGGAGTTCAAGTTCAAAGAGAGCGAGAAAG
AA
AAACAGCTGGAGTTAGAGAATCTTCAAGCATCATATGAAGACCTGAAGGCACAATCACAAGAAGAGAT
C
AGGCGCTTGTGGTCCCAGCTTGATTCTGCCAGGACCAGTAGACAGGAATTGAGTGAGCTACATGAGCAA
CTC
CTGGCGCGCACCTCTCGTGTGGAAGATTTAGAACAGCTGAAGCAGCGAGAAAAAACCCAGCATGAGT
CC
GAACTGGAGCAACTGAGGATTTATTTTGAAAAGAAGTTAAGGGATGCTGAGAAAACTTACCAAGAAGA
C
CTAACCCTGTTACAGCAGAGGCTGCAGGGGGCGAGGGAAGATGCTCTTCTGGACTCTGTGGAAGTTGGG
TTG
TCCTGTGTGGGTTTAGAAGAGAAACCTGAGAAAGGAAGAAAAGATCACGTTGATGAACTCGAGCCTG
AG
CGACATAAGGAGAGCCTGCCACGCTTCCAGGCGGAGTTAGAAGAAAGCCACAGGCACCAGCTGGAAGC
G
CTGGAGTCTCCCCTCTGCATCCAGCACGAGGGGCATGTCTCAGACAGATGCTGCGTAGAGACTTCAGCA
TTG
GGACACGAGTGGCGTCTGGAACCCTCTGAAGGGCACAGCCAAGAGCTTCCCTGGGTGCATCTCCAGG
GT
GTGCAGGACGGGGACTTGGAGGCCGACACAGAGCGGGCAGCCAGAGTCTTGGGTCTGGAAACTGAGCA
C
AAGGTGCAACTTTCGCTTCTTCAGACTGAGCTCAAAGAAGAAATTGAACTCCTAAAAATAGAAAATAGA
AAT
TTGTATGGGAAGTTGCAGCATGAAACTCGTCTGAAGGACGATTTGGAGAAGGTAAAACACAATCTAA
TT
GAAGACCACCAGAAGGAACTAAATAATGCTAAGCAAAAGACTGAGCTGATGAAACAGGAATTCCAAAG
A
AAAGAAACGGACTGGAAAGTTATGAAGGAGGAGCTACAGCGGGAAGCTGAGGAGAAGTTAACATTGATG
CTA
CTTGAACTGAGAGAAAAGGCTGAATCCGAGAAACAGACCATCATAAACAAGTTTGAGCTTCGAGAAG
CT
GAAATGAGGCAGCTTCAGGACCAACAGGCAGCCCAGATCCTGGATCTGGAGAGGTCCTTGACGGAGCA
G
CAGGGCCGCCTGCAGCAGCTGGAACAGGACCTCACTTCAGACGACGCCCTGCATTGCAGCCAGTGTGGG
CGG
GAGCCGCCCACAGCCCAGGACGGGGAGCTTGCTGCGCTCCACGTGAAGGAAGACTGCGCCCTGCAGC
TG
ATGCTGGCCCGGAGCAGGTTTTTAGAGGAACGTAAAGAGATCACCGAGAAATTCAGTGCGGAACAAGA
T
GCCTTCCTGCAGGAGGCCCAGGAGCAGCATGCCCGTGAGCTGCAGCTCCTCCAGGAGAGACACCAGCAG
CAG
CTCCTGTCAGTGACGGCGGAGCTCGAGGCCAGACACCAGGCCGCGTTGGGCGAGCTGACAGCCTCCT
TA
GAGAGCAAGCAGGGGGCTCTGCTGGCTGCACGTGTGGCCGAACTGCAGACAAAACACGCTGCCGACCT
C
GGCGCTCTGGAGACCAGACATCTGTCCAGCCTTGATTCTTTGGAATCCTGTTACCTCTCTGAATTTCAG
ACC
ATCCGTGAGGAGCACAGGCAGGCCCTAGAGCTCTTACGAGCAGACTTTGAGGAACAACTGTGGAAAA
AG
GACTCTCTTCACCAAACGATTTTGACTCAAGAGTTGGAGAAACTGAAGCGGAAACACGAAGGGGAGCT
A
CAGTCTGTGCGGGACCACCTGCGAACCGAAGTGAGCACAGAGCTCGCCGGAACCGTGGCTCACGAGCTG
CAG
GGAGTGCACCAGGGTGAATTTGGAAGTGAAAAGAAAACTGCTTTGCATGAAAAAGAGGAGACACTTC
GG
CTTCAGAGTGCACAGGCACAGCCTTTTCACCAAGAGGAGAAAGAGTCTTTGTCTCTGCAGCTTCAAAA
G
AAGAATCACCAAGTCCAGCAGCTGAAAGACCAGGTTTTATCCTTAAGTCACGAGATAGAAGAGTGCCGC
TCC
GAGTTGGAGGTGCTGCAGCAGAGGCGGGAGCGGGAGAACCGGGAAGGCGCAAACCTCCTCTCCATGC
TC
AAGGCCGACGTCAACCTGTCCCACAGCGAAAGAGGGGCCCTCCAGGACGCCCTGCGCAGGCTGCTGGG
T
TTGTTTGGAGAGACGCTGAGGGCAGCCGTCACCCTGAGGAGCCGGATCGGGGAGCGCGTGGGGCTCTGC
CTG
GATGACGCGGGCGCAGGCCTGGCCCTGTCGACAGCTCCGGCGCTGGAGGAGACATGGTCTGATGTGG
CC
CTCCCGGAGTTGGACAGAACTTTGTCTGAATGTGCAGAGATGTCTTCCGTGGCTGAAATTAGCAGCCA
C
ATGCGTGAAAGCTTTCTCATGAGCCCAGAAAGTGTGCGGGAGTGTGAGCAGCCCATCCGGAGGGTCTTC
CAG
AGCCTCAGCCTGGCCGTGGACGGCCTCATGGAGATGGCCCTGGACTCCAGCAGGCAGCTGGAAGAAG
CA
CGCCAAATTCATTCTCGTTTTGAAAAAGAATTTAGTTTTAAGAATGAGGAGACAGCACAGGTTGTCAG
G
AAGCACCAGGAGCTGCTGGAGTGTTTGAAGGAGGAGAGCGCAGCAAAGGCAGAGCTGGCGCTGGAGCTG
CAC
AAGACTCAGGGTACCCTTGAGGGATTCAAGGTGGAGACAGCAGATCTGAAGGAGGTGCTGGCCGGGA
AG
GAGGATTCCGAGCACCGTCTGGTGCTGGAGCTGGAGAGCCTGAGACGGCAGCTGCAGCAGGCGGCCCA
G
GAGCAGGCGGCGCTGAGGGAGGAGTGCACCCGTCTGTGGAGTCGGGGGGAGGCCACAGCCACGGACGCC
GAG
GCCAGAGAAGCTGCTCTCCGGAAGGAAGTGGAGGATCTGACCAAAGAACAGTCGGAGACCAGGAAGC
AG
GCTGAGAAGGACCGCTCAGCCCTGCTCTCCCAGATGAAGATTTTGGAGTCTGAGTTAGAAGAACAGCT
G
TCTCAGCATCGCGGGTGTGCCAAGCAGGCGGAGGCCGTCACTGCCCTGGAACAGCAGGTGGCATCTCTG
GAC
AAGCATTTGCGCAACCAGCGGCAATTCATGGATGAGCAGGCAGCCGAGCGGGAGCACGAGCGCGAGG
AG
TTCCAGCAGGAGATTCAGAGGCTGGAGGGGCAGCTCCGCCAGGCGGCCAAGCCGCAGCCCTGGGGCCC
T
CGCGACAGCCAGCAGGCGCCGCTGGATGGAGAGGTTGAGTTGTTACAACAAAAGTTGAGAGAAAAGTTG
GAT
GAATTTAATGAATTGGCTATACAGAAAGAGTCGGCAGATAGACAAGTGTTAATGCAGGAAGAAGAAA
TT
AAACGTCTGGAGGAGATGAACATCAACATCAGGAAAAAAGTGGCCCAGCTCCAGGAAGAAGTGGAAAA
A
CAGAAAAACATCGTGAAAGGGCTGGAACAGGATAAAGAGGTGTTAAAGAAACAGCAGATGAGTAGCTTG
CTT
CTGGCGTCCACGTTGCAGTCTACACTAGATGCAGGCAGATGTCCCGAGCCTCCTTCGGGCAGCCCTC
CT
GAGGGTCCAGAAATACAGTTAGAGGTGACACAGAGAGCACTCCTGCGGCGCGAGAGCGAGGTTTTGGA
C
TTAAAAGAACAGCTAGAAAAGATGAAAGGTGACTTAGAAAGTAAAAATGAAGAAATACTACATCTGAAC
TTA
AAATTGGACATGCAGAACAGCCAGACTGCTGTCAGCCTCAGAGAACTTGAGGAAGAGAACACGAGCT
TG
AAGGTCATATATACCAGAAGTTCTGAGATTGAAGAGCTGAAAGCCACTATTGAAAATCTGCAAGAGAA
T
CAGAAACGATTACAAAAGGAGAAAGCAGAGGAAATTGAACAACTCCATGAAGTCATTGAGAAGCTGCAG
CAC
GAGCTGTCCCTCATGGGGCCTGTGGTGCACGAAGTCAGCGACAGTCAGGCTGGCAGTCTGCAGAGCG
AG
CTGCTCTGCTCCCAGGCCGGGGGCCCTCGTGGGCAGGCCCTACAGGGCGAGCTCGAGGCTGCGCTGGA
A
GCCAAGGAGGCCCTGAGCCGGCTGCTGGCTGACCAGGAGCGCAGGCACAGCCAGGCCCTGGAGGCCCTG
CAG
CAGCGCCTCCAGGGCGCAGAGGAGGCTGCGGAGCTACAGCTGGCTGAGCTGGAGCGCAATGTAGCCC
TC
AGGGAGGCTGAGGTCGAAGACATGGCCTCCCGGATCCAGGAGTTCGAAGCGGCCCTGAAAGCAAAGGA
A
GCGACGATTGCCGAGAGAAATTTAGAAATCGACGCTCTGAACCAGCGGAAGGCGGCCCACTCTGCCGAG
CTG
GAGGCCGTCCTGTTGGCCTTGGCCCGCATCCGCCGCGCCCTGGAGCAGCAGCCCCTGGCAGCCGGGG
CG
GCGCCTCCCGAGCTGCAGTGGCTCCGAGCGCAGTGTGCCCGCCTCAGCCGCCAGCTGCAGGTGCTGCA
C
CAGCGGTTCCTGAGGTGCCAGGTGGAGCTGGACAGGCGGCAGGCCCGCAGAGCCACAGCTCACACACGG
GTG
CCCGGGGCCCACCCACAGCCTCGCATGGATGGTGGCGCCAAGGCCCAGGTCACCGGCGACGTGGAGG
CC
TCCCATGATGCTGCTTTGGAGCCGGTTGTCCCTGACCCACAGGGTGATCTGCAGCCTGTCCTGGTGAC
G
TTGAAGGATGCACCTCTCTGCAAGCAAGAAGGCGTGATGTCAGTGCTCACCGTCTGCCAGAGGCAGCTG
CAG
TCGGAGCTGCTCTTGGTGAAAAATGAAATGCGCCTGAGTCTGGAGGACGGCGGCAAGGGTAAAGAAA
AA
GTACTGGAAGATTGTCAGCTGCCGAAGGTCGATCTCGTAGCTCAGGTGAAACAGCTTCAGGAAAAACT
G
AACCGTTTGCTGTATTCCATGACCTTCCAGAATGTGGATGCTGCCGACACCAAATCTCTGTGGCCCATG
GCC
TCAGCACACCTGTTGGAGAGCAGCTGGAGTGATGATTCCTGTGACGGAGAAGAGCCTGACATATCAC
CC
CACATAGACACATGTGATGCCAATACAGCCACGGGGGGTGTAACTGATGTTATCAAAAATCAGGCCAT
A
GACGCGTGTGATGCCAATACAACCCCAGGGGGTGTAACTGATGTTATCAAAAATTGGGATTCCTTGATA
CCA
GATGAAATGCCAGATTCTCCCATTCAAGAAAAATCAGAATGTCAGGACATGTCTCTTTCTTCACCGA
CC
AGCGTACTTGGTGGCTCCCGCCACCAGAGCCACACTGCAGAGGCTGGGCCCCGGAAGAGCCCGGTCGG
G
ATGCTGGACCTGTCTTCCTGGAGCTCCCCTGAGGTCCTCAGGAAGGACTGGACCCTGGAGCCCTGGCCC
AGC
CTCCCCGTGACACCCCACTCAGGAGCCCTGAGCCTGTGCAGTGCCGACACATCCCTGGGGGACAGGG
CG
GACACCTCGCTGCCACAGACCCAGGGGCCGGGGCTGCTTTGTTCCCCAGGCGTGTCTGCAGCAGCGCT
G
GCACTGCAGTGGGCCGAGTCTCCGCCGGCTGACGACCACCATGTGCAGAGGACGGCTGTGGAGAAAGAT
GTC
GAAGATTTTATCACAACATCCTTTGATTCTCAAGAAACATTAAGTTCACCTCCTCCTGGATTAGAAG
GA
AAAGCTGATAGAAGTGAGAAAAGTGACGGCTCGGGTTTTGGAGCAAGACTGAGCCCGGGGTCAGGAGG
C
CCTGAGGCTCAAACTGCTGGTCCTGTGACCCCTGCTTCCATCTCTGGAAGGTTTCAGCCGCTGCCGGAA
GCC
ATGAAGGAGAAGGAAGTGCGTCCGAAGCACGTGAAGGCTTTACTGCAGATGGTGCGTGACGAGAGCC
AC
CAGATCCTGGCGCTGTCAGAAGGCCTTGCACCCCCAAGCGGCGAGCCACACCCACCCCGGAAGGAAGA
C
GAGATACAGGACATCTCGCTCCATGGGGGAAAGACGCAGGAAGTGCCCACCGCGTGCCCCGATTGGAGA
GGG
GACCTTCTGCAGGTTGTGCAAGAGGCCTTTGAAAAAGAGCAGGAGATGCAGGGGGTTGAGCTGCAGC
CC
CGACTCAGTGGCTCAGATCTGGGGGGTCACAGCTCCCTGCTCGAAAGGCTGGAGAAGATCATCCGTGA
G
CAGGGAGACCTGCAGGAAAAGTCCCTGGAGCATCTTCGCTTGCCGGACCGGAGCAGCCTGCTGTCCGAG
ATC
CAGGCGCTGCGTGCCCAGCTGCGCATGACGCACCTGCAGAACCAGGAGAAGCTGCAGCACTTGCGCA
CG
GCGCTGACAAGCGCAGAGGCGCGCGGGAGCCAGCAGGAGCACCAGCTGCGCAGGCAGGTTGAACTGCT
G
GCTTATAAAGTAGAGCAGGAGAAGTGCATTGCTGGTGACTTGCAGAAGACGCTGAGTGAAGAGCAAGAG
AAG
GCAAACAGCGTGCAGAAGCTCCTGGCGGCGGAGCAGACTGTAGTGCGAGATTTGAAGTCCGACCTCT
GT
GAGAGCAGGCAGAAGAGCGAACAGCTGTCCCGGTCCCTCTGCGAGGTGCAGCAGGAGGTCCTCCAGCT
G
AGATCCATGCTGAGCAGTAAGGAGAACGAGCTGAAGGCCGCGCTTCAGGAGCTGGAGAGTGAGCAGGGG
AAG
GGGCGTGCCCTGCAGAGCCAGCTGGAGGAGGAGCAGCTGCGGCACCTGCAGAGGGAGAGCCAGAGTG
CC
AAGGCCCTGGAGGAGCTGCGGGCGTCTTTGGAGACACAGCGTGCTCAGAGCAGTCGACTCTGCGTGGC
A
CTGAAACACGAGCAGACGGCCAAGGACAACCTGCAGAAGGAGCTGCGTATCGAGCACTCACGCTGCGAG
GCC
TTGCTGGCTCAGGAGCGGAGCCAGCTCTCTGAGCTCCAGAAGGACCTTGCGGCTGAGAAGAGCCGCA
CC
CTGGAGCTGTCAGAGGCCTTGCGGCACGAGCGGCTCCTGACCGAGCAGCTGAGCCAGAGGACACAGGA
G
GCTTGCGTGCACCAGGACACACAGGCCCATCACGCTCTGCTGCAGAAGCTGAAGGAGGAGAAGTCCCGG
GTG
GTGGACTTGCAAGCGATGCTTGAAAAGGTGCAGCAGCAAGCCCTGCATTCTCAGCAGCAGCTTGAGG
CT
GAGGCTCAGAAGCACTGTGAGGCGCTCAGGAGAGAGAAGGAGGTAAGTGCCACACTGAAGTCGACGGT
G
GAAGCCCTGCACACCCAAAAACGAGAGCTGAGATGCTCTCTGGAGAGAGAGAGGGAGAAACCAGCGTGG
TTG
CAGGCAGAATTAGAGCAGTCACACCCACGGTTGAAAGAGCAAGAAGGACGCAAGGCTGCGAGGAGGA
GC
GCGGAGGCCAGGCAGAGCCCAGCGGCTGCGGAGCAGTGGAGGAAGTGGCAGAGAGACAAGGAGAAGCT
G
CGAGAATTAGAACTGCAGCGTCAGCGTGACTTGCATAAGATCAAGCAGCTTCAGCAGACAGTGAGAGAC
CTG
GAGTCGAAGGACGAGGTGCCTGGCAGCCGCCTCCACCTAGGTTCTGCCCGCAGGGCTGCCGGCTCGG
AT
GCGGACCACCTCCGGGAACAGCAGCGAGAGCTGGAGGCGATGAGGCAGCGGCTGCTCTCTGCCGCCCG
G
CTTCTCACCAGCTTCACCAGCCAGGCCGTGGACAGGACAGTTAATGATTGGACGTCATCCAATGAGAAA
GCA
GTGATGTCTTTACTGCACACGTTGGAGGAGCTGAAGTCTGACTTGAGCAGGCCCACCTCCTCCCAGA
AA
AAAATGGCAGCAGAGCTGCAGTTCCAGTTTGTGGACGTCCTGCTGAAAGACAATGTTTCCCTCACAAA
A
GCGCTCAGCACGGTGACCCAGGAGAAGCTGGAGCTGAGCAGAGCCGTGTCTAAGCTTGAGAAGTTGCTG
AAG
CACCATCTGCAGAAGGGCTGCAGCCCAAGCAGGTCGGAAAGGTCTGCTTGGAAGCCAGACGAAACGG
CT
CCACAGAGTTCCCTGAGGCGCCCAGACCCCGGCCGGCTTCCACCAGCTGCCAGCGAGGAAGCACACAC
C
AGCAATGTCAAGATGGAAAAATTGTACCTGCATTACTTGAGAGCAGAGAGCTTTAGAAAAGCTCTGATT
TAT
CAAAAGAAGTATCTTTTGCTGTTGATTGGTGGATTCCAGGATTCTGAACAAGAAACACTCTCCATGA
TT
GCCCATTTGGGGGTATTTCCTTCCAAAGCAGAACGGAAAATCACATCTCGTCCTTTCACCAGGTTCCG
C
ACGGCCGTCAGGGTGGTCATTGCAATATTAAGATTACGTTTTTTGGTTAAGAAATGGCAAGAAGTAGAT
CGG
AAAGGAGCTCTGGCACAAGGCAAAGCCCCTCGCCCAGGGCCCCGAGCACGACAGCCGCAGTCTCCAC
CC
AGAACCAGAGAGTCCCCCCCAACCCGGGATGTACCCTCTGGCCACACCAGGGACCCTGCCAGAGGCCG
C
AGACTGGCAGCAGCAGCCTCCCCACACAGTGGGGGAAGAGCCACTCCATCCCCAAATTCAAGATTAGAA
AGA
TCCCTGACTGCTTCTCAAGATCCAGAACATTCCTTGACAGAGTATATTCACCATTTAGAAGTGATCC
AG
CAAAGATTGGGAGGGGTACTACCAGATTCTACTTCAAAGAAATCCTGCCACCCGATGATTAAACAGTG
A


Translation (3336 aa):
MEVEQEQRRRKVEAGRTKLAHFRQRKTKGDSSHSEKKTAKRKGSAVDASVQEESPVTKEDSALCGGGDIC
K
STSCDDTPDGAGGAFAAQ
PEDCDGEKREDLEQLQQKQVNDHPPEQCGMFTVSDHPPEQHGMFTVGDHPP
E
QRGMFTVSDHPPEQHGMFTVSDHPPEQRGMFTISDHQPEQRGMFTVSDHTPEQRGIFTISDHPAEQRGM
F
TK
ECEQECELAITDLESGREDEAGLHQSQAVHGLELEALRLSLSNMHTAQLELTQANLQKEKETALTEL
R
EMLNSRRAQELALLQSRQQHELELLREQHAREKEEVVLRCGQEA
AELKEKLQSEMEKNAQIVKTLKEDW
E
SEKDLCLENLRKELSAKHQSEMEDLQNQFQKELAEQRAELEKIFQDKNQAE
RALRNLESHHQAAIEKLR
E
DLQSEHGRCLEDLEFKFKESEKEKQLE
LENLQASYEDLKAQSQEEIRRLWSQLDSARTSRQELSELHEQ
L
LARTSRVEDLEQLKQREKTQHESELEQLRIYFEKKLRDAEKTYQEDLTLLQQRLQGAREDALLDSVEV
G
L
SCVGLEEKPEKGRKDHVDELEPERHK
ESLPRFQAELEESHRHQLEALESPLCIQHEGHVSDRCCVETSA
L
GHEWRLEPSEGHSQ
ELPWVHLQGVQDGDLEADTERAARVLGLETEHKVQLSLLQTELKEEIELLKIENR
N
LYGKLQHETRLKDDLEK
VKHNLIEDHQKELNNAKQKTELMKQEFQRKETDWKVMKEELQREAEEKLTLM
L
LELREKAESEKQTIINKFELREAEMRQLQDQQAAQILDLERSLTEQQGRLQQLEQDLTSDDALHCSQCG
R
EPPTAQDGELAALHVKEDCALQLMLARS
RFLEERKEITEKFSAEQDAFLQEAQEQHARELQLLQERHQQ
Q
LLSVTAELEARHQAALGELTASLESKQGALLAARVAELQTKHAADLGALETRHLSSLDSLESCYLSEFQ
T
IREEHRQALELLRADFEEQLWKKDSLHQTILTQELEKLKRKHEGELQSVRDHLRTEVSTELAGTVAHEL
Q
GVHQ
GEFGSEKKTALHEKEETLRLQSAQAQPFHQEEKESLSLQLQKKNHQVQQLKDQVLSLSHEIEECR
S
ELEVLQQRRERENREGANLLSMLKADVNLSHSE
RGALQDALRRLLGLFGETLRAAVTLRSRIGERVGLC
L
DDAGAGLALST
APALEETWSDVALPELDRTLSECAEMSSVAEISSHMRESFLMSPESVRECEQPIRRVF
Q
SLSLAVDGLMEMALDSSRQ
LEEARQIHSRFEKEFSFKNEETAQVVRKHQELLECLKEESAAKAELALEL
H
KTQ
GTLEGFKVETADLKEVLAGKEDSEHRLVLELESLRRQLQQAAQEQAALREECTRLWSRGEATATDA
E
AREA
ALRKEVEDLTKEQSETRKQAEKDRSALLSQMKILESELEEQLSQHRGCAKQAEAVTALEQQVASL
D
KHLRNQRQFMD
EQAAEREHEREEFQQEIQRLEGQLRQAAKPQPWGPRDSQQAPLDGEVELLQQKLREKL
D
EFNELAIQKESADRQVLMQEEEIKRLEEMNINIRKKVAQLQEEVEKQKNIVKGLEQ
DKEVLKKQQMSSL
L
LASTLQSTLDAGRCPEPPSGSPPEGPEIQLEVTQRALLRRESE
VLDLKEQLEKMKGDLESKNEEILHLN
L
KLDMQNSQTAVSLRELEEENTSLK
VIYTRSSEIEELKATIENLQENQKRLQKEKAEEIEQLHEVIEKLQ
H
ELSLMGPVVHEVSDSQAGSLQSELLCSQAGGPRGQALQGELEAALEAKEALSRLLADQERRHSQALEAL
Q
QRLQGAEEAAELQLAELERNVALREAEVEDMASRIQEFEAALKAKEATIAERNLEIDALNQRKAAHSAE
L
EAVLLALARIRRALEQQPLAAGAAPPELQWLRAQCARLSRQLQVLHQRFLRCQVELDRRQARRATAHTR
V
PGAHPQPRMDGGAKAQVTGDVEASHDAALEPVVPDPQ
GDLQPVLVTLKDAPLCKQEGVMSVLTVCQRQL
Q
SELLLVKNEMRLSLEDGGK
GKEKVLEDCQLPKVDLVAQVKQLQEKLNRLLYSMTFQNVDAADTKSLWPM
A
SAHLLESSWSDDSCDGEEPDISPHIDTCDANTATGGVTDVIKNQAIDACDANTTPGGVTDVIKNWDSLI
P
DEMPDSPIQEKSECQDMSLSSPTSVLGGSRHQSHTAEAGPRKSPVGMLDLSSWSSPEVLRKDWTLEPWP
S
LPVTPHSGALSLCSADTSLGDRADTSLPQTQGPGLLCSPGVSAAALALQWAESPPADDHHVQRTAV
EKD
V
EDFITTSFDSQETLSSPPPGLEGKADRSEK
SDGSGFGARLSPGSGGPEAQTAGPVTPASISGRFQPLPE
A
MKEKEVRPKHVK
ALLQMVRDESHQILALSEGLAPPSGEPHPPRKEDEIQDISLHGGKTQEVPTACPDWR
G
DLLQVVQEAFEKEQEMQGVELQPRLSGSDLGGHSSLLERLEKIIREQ
GDLQEKSLEHLRLPDRSSLLSE
I
QALRAQLRMTHLQNQEKLQHLRTALTSAEARGSQQEHQLRRQ
VELLAYKVEQEKCIAGDLQKTLSEEQE
K
ANSVQKLLAAEQTVVRDLKSDLCESRQKSEQLSRSLCEVQQEVLQL
RSMLSSKENELKAALQELESEQG
K
GRALQSQLEEEQLRHLQRESQSAKALE
ELRASLETQRAQSSRLCVALKHEQTAKDNLQKELRIEHSRCE
A
LLAQERSQLSELQKDLAAEKSRTLELSEALRHERLLTEQLSQRTQEACVHQDTQAHHALLQKLKEEKSR
V
VDLQAMLEKVQQQALHSQQQLEAEAQKHCEALRREKEVSATLKSTVEALHTQKRELRCSLEREREKPAW
L
QAELEQSHPRLKEQEGRKAARRSAEARQSPAAAEQWRKWQRDKEKL
RELELQRQRDLHKIKQLQQTVRD
L
ESKDEVPGSRLHLGSARRAAGSDADHLREQQRELEAMRQRLLSAARLLTSFTSQAVD
RTVNDWTSSNEK
A
VMSLLHTLEELKSDLSRPTSSQ
KKMAAELQFQFVDVLLKDNVSLTKALSTVTQEKLELSRAVSKLEKLL
K
HHLQKGCSPS
RSERSAWKPDETAPQSSLRRPDPGRLPPAASEEAHTSNVKMEKLYLHYLRAESFRKALI
Y
QKKYLLLLIGGFQDSEQETLSMIAHLGVFPSKAERKITSRPFTRFRTAVRVVIAIL
RLRFLVKKWQEVD
R
KGALAQGKAPRP
GPRARQPQSPPRTRESPPTRDVPSGHTRDPARGRRLAAAASPHSGGRATPSPNSRLE
R
SLTASQDPEHSLTEYIHHLEVIQQRLGGVLP
DSTSKKSCHPMIKQ



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser