NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS33539.2 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
33539.2 Public Homo sapiens 21 SYNJ1 22 109 92 CCDS HistoryNCBI Gene:8867Re-query CCDS DB by CCDS ID:33539.2Re-query CCDS DB by GeneID:8867See the combined annotation on chromosome 21 in Sequence Viewer

Public Note for CCDS 33539.1
The coding region has been updated to extend the N-terminus to one that is more supported by the available transcript and conservation data.

Public since: CCDS release 3, NCBI annotation release 36.2, Ensembl annotation release 41

Review status: Reviewed (by RefSeq, Havana and CCDS collaboration)

Sequence IDs included in CCDS 33539.2

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000433931.6 ENSP00000409667.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000433931.6Link to Ensembl Protein Viewer:ENSP00000409667.2Re-query CCDS DB by Nucleotide ID:ENST00000433931Re-query CCDS DB by Protein ID:ENSP00000409667
Original member Current member NCBI NM_003895.3 NP_003886.3 Accepted alive Link to Nucleotide Sequence:NM_003895.3Link to Protein Sequence:NP_003886.3Re-query CCDS DB by Nucleotide ID:NM_003895Re-query CCDS DB by Protein ID:NP_003886Link to BLAST:NP_003886.3

Chromosomal Locations for CCDS 33539.2

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 21 (NC_000021.9)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21See the combined annotation on chromosome 21 in Sequence Viewer

Chromosome Start Stop Links
21 32630995 32631801 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 32638908 32639125 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 32639671 32639779 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 32641896 32641966 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 32642095 32642133 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 32643410 32643457 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 32644968 32645006 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 32645646 32645789 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 32646393 32646602 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 32650184 32650346 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 32653288 32653366 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 32656687 32656902 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 32657003 32657120 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 32657716 32657872 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 32664913 32665071 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 32665943 32666135 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 32666433 32666573 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 32670288 32670372 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 32673340 32673531 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 32676332 32676355 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 32678645 32678801 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 32681496 32681648 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 32684038 32684119 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 32685748 32685917 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 32686978 32687074 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 32688306 32688367 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 32694228 32694311 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 32695057 32695282 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 32699838 32700105 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 32701961 32702047 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 32726772 32726917 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 32727946 32728040 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (4839 nt):
ATGCGGAAGAGATGGGCCTGCTGGAGCGGAAGTGACGCTCCCGGCGGCTGTGGCGGCGGCTGCGGGAGAA
GG
AGGAGGAGGAGCCGGAGGAAGAGGGCTGCCTCCGAAGAAAGGAGAATGGCGTTCAGTAAAGGATTCCG
G
ATCTATCACAAATTGGATCCCCCACCTTTCAGCCTCATAGTGGAAACTAGGCATAAGGAAGAATGTCTC
ATG
TTCGAGTCTGGGGCTGTCGCTGTGCTCTCATCTGCAGAAAAAGAGGCAATCAAGGGTACATACTCCA
AA
GTACTGGATGCATATGGACTCTTAGGTGTTCTGCGGTTAAATCTTGGTGATACTATGTTACATTATCT
G
GTCCTAGTCACTGGATGTATGTCTGTTGGAAAAATTCAAGAATCTGAAGTTTTCCGAGTTACTTCCACT
GAG
TTTATATCACTGCGAATCGATTCTTCAGATGAGGATCGCATTTCAGAAGTGCGGAAAGTTTTGAATT
CA
GGAAACTTTTATTTTGCATGGTCTGCATCTGGCATCAGTTTAGATTTGAGTCTTAATGCGCATCGTAG
C
ATGCAAGAACAGACAACTGATAATAGATTTTTCTGGAATCAGTCTTTGCATTTGCATCTCAAACACTAT
GGC
GTGAATTGTGATGACTGGTTATTACGTCTTATGTGTGGAGGAGTAGAAATCAGAACAATTTATGCTG
CT
CATAAACAGGCGAAGGCTTGCCTCATTTCAAGATTAAGCTGTGAACGAGCTGGGACCAGGTTTAATGT
C
CGGGGAACAAATGATGATGGTCATGTTGCCAATTTTGTAGAAACAGAACAGGTTGTGTACTTAGATGAC
TCA
GTTTCTTCCTTCATACAAATCCGAGGATCTGTTCCATTGTTCTGGGAGCAACCAGGGTTGCAAGTGG
GA
TCTCATCGTGTCCGTATGTCAAGGGGATTTGAAGCCAATGCACCTGCTTTTGACAGGCATTTTAGAAC
A
CTTAAGAACTTATATGGTAAACAAATAATAGTAAATTTGCTTGGATCTAAGGAAGGTGAACATATGCTA
AGT
AAAGCTTTCCAGAGTCATTTGAAAGCTTCTGAACATGCTGCTGATATCCAGATGGTGAATTTTGACT
AT
CATCAAATGGTTAAGGGAGGAAAGGCAGAAAAATTACATAGTGTTCTTAAACCTCAAGTCCAGAAGTT
T
CTAGATTATGGATTTTTTTATTTCAATGGAAGTGAAGTTCAAAGATGCCAGAGTGGTACAGTTCGAACA
AAC
TGCTTGGATTGTCTTGATAGAACAAATAGTGTGCAGGCATTTCTTGGCTTAGAGATGCTAGCTAAAC
AG
TTGGAAGCTCTTGGTTTAGCTGAAAAGCCTCAGTTGGTGACTCGCTTTCAAGAAGTTTTTCGGTCAAT
G
TGGTCCGTGAATGGTGATTCAATCAGTAAGATATATGCAGGAACTGGAGCTCTTGAAGGGAAAGCGAAG
TTA
AAAGATGGTGCTCGCTCTGTTACCCGAACAATTCAGAATAACTTCTTTGACAGCTCCAAGCAAGAGG
CC
ATTGATGTTTTGCTACTGGGAAATACTCTGAATAGTGATTTAGCTGACAAAGCTCGAGCACTTTTAAC
T
ACTGGAAGTTTGCGTGTTTCTGAGCAGACATTACAGTCAGCATCTTCTAAAGTACTAAAGAGCATGTGT
GAG
AATTTCTACAAATATTCAAAGCCTAAGAAAATTCGAGTATGTGTCGGAACCTGGAATGTGAATGGTG
GG
AAGCAATTTCGCAGCATAGCTTTTAAGAATCAGACACTCACTGACTGGCTTCTTGATGCACCCAAGTT
A
GCTGGCATCCAGGAGTTTCAAGATAAAAGAAGTAAGCCAACTGATATATTTGCAATTGGTTTTGAAGAA
ATG
GTAGAATTGAATGCTGGAAACATTGTGAGTGCAAGCACAACAAATCAGAAGCTCTGGGCTGTAGAAC
TT
CAGAAGACAATCTCCAGAGACAACAAGTATGTGCTGCTGGCTTCTGAACAGTTGGTGGGCGTCTGTTT
G
TTTGTTTTTATCAGACCACAGCATGCTCCTTTTATCAGGGATGTTGCAGTTGATACTGTGAAGACTGGA
ATG
GGAGGTGCAACTGGAAATAAGGGAGCAGTTGCAATCCGAATGCTCTTCCATACAACCAGCCTTTGCT
TC
GTCTGTAGCCACTTTGCTGCAGGGCAGTCACAAGTCAAAGAAAGAAATGAAGATTTTATAGAAATAGC
A
CGAAAATTGAGTTTTCCTATGGGAAGGATGCTATTTTCCCATGACTATGTATTTTGGTGTGGTGATTTC
AAC
TATCGAATCGATCTCCCTAACGAAGAAGTTAAAGAGCTCATAAGACAGCAAAATTGGGATTCTCTTA
TA
GCAGGAGATCAACTTATCAATCAGAAAAATGCTGGACAGGTTTTTAGAGGATTTTTAGAAGGAAAGGT
A
ACCTTTGCTCCGACATATAAGTATGACTTGTTTTCTGACGACTATGACACCAGTGAAAAGTGCCGCACC
CCT
GCCTGGACAGACCGTGTCCTTTGGAGAAGGAGGAAATGGCCTTTTGATAGATCAGCTGAAGATCTAG
AT
CTTCTAAATGCTAGTTTTCAAGATGAAAGCAAAATTCTGTACACGTGGACTCCAGGCACTTTGCTGCA
C
TATGGAAGAGCTGAGCTGAAGACTTCTGACCACAGGCCTGTCGTTGCCCTGATTGATATAGATATATTT
GAA
GTTGAAGCTGAAGAGAGGCAAAACATTTATAAAGAAGTAATTGCAGTTCAGGGTCCACCAGATGGTA
CA
GTATTGGTCTCAATCAAAAGTTCTTTACCAGAAAATAATTTTTTTGATGATGCCTTGATTGATGAGCT
T
CTGCAGCAGTTTGCAAGTTTTGGTGAAGTTATACTTATAAGATTTGTAGAAGATAAAATGTGGGTTACA
TTT
TTGGAGGGAAGCTCTGCCTTGAATGTTCTGAGCCTAAATGGTAAAGAGTTATTGAATCGGACTATAA
CT
ATTGCTTTAAAAAGTCCAGACTGGATCAAAAATTTGGAAGAAGAAATGAGTTTAGAGAAAATTAGCAT
T
GCATTGCCATCATCAACAAGCTCTACCCTGCTTGGTGAAGATGCAGAGGTTGCAGCAGATTTTGATATG
GAA
GGTGATGTTGATGACTATAGTGCTGAAGTGGAGGAACTTCTTCCTCAGCATCTCCAGCCATCTTCAA
GT
TCCGGCCTTGGTACTTCCCCCAGCTCTTCACCCCGAACTAGTCCCTGCCAGTCACCTACAATATCAGA
G
GGTCCTGTACCTTCCCTTCCCATCAGACCAAGCCGAGCACCGTCAAGAACTCCTGGGCCTCCCAGTGCA
CAG
AGTTCTCCTATTGACGCGCAGCCAGCAACGCCGCTGCCGCAGAAAGACCCCGCCCAGCCCTTGGAGC
CC
AAGCGGCCGCCGCCGCCCCGCCCGGTCGCCCCTCCCACACGCCCGGCTCCCCCACAGAGACCTCCTCC
G
CCTTCAGGGGCTAGGAGTCCTGCACCCACTAGAAAGGAATTTGGAGGTATTGGAGCCCCTCCCAGTCCT
GGG
GTAGCTAGGAGAGAGATGGAAGCACCCAAAAGCCCTGGAACAACAAGGAAAGATAATATAGGACGCA
GT
CAGCCTTCACCTCAAGCAGGACTTGCAGGCCCAGGACCTGCTGGATACAGTACAGCCAGACCGACGAT
T
CCTCCTCGTGCTGGAGTTATCAGTGCCCCACAGAGCCACGCGCGGGCATCTGCTGGAAGACTGACTCCT
GAA
AGCCAAAGCAAAACATCAGAAACGTCGAAAGGTTCAACTTTCCTTCCTGAACCACTGAAGCCTCAGG
CT
GCTTTTCCTCCGCAGTCTTCTTTGCCCCCGCCTGCTCAAAGGTTGCAAGAGCCTCTTGTCCCTGTGGC
A
GCACCTATGCCTCAGTCTGGCCCCCAGCCAAATTTGGAAACCCCACCACAACCACCACCTCGAAGCAGG
TCA
TCCCATAGCTTGCCTTCAGAAGCTTCCTCACAACCGCAAGTAAAAACAAATGGAATCTCTGATGGCA
AA
AGAGAATCACCATTAAAGATTGACCCATTTGAAGATCTGTCATTTAATCTGCTTGCTGTATCAAAGGC
T
CAGCTATCTGTTCAAACGTCACCTGTTCCCACCCCAGACCCAAAGAGGTTGATTCAGTTGCCTTCTGCA
ACG
CAAAGTAATGTTTTGAGTTCTGTAAGTTGCATGCCAACAATGCCTCCAATTCCAGCTCGGAGTCAAT
CC
CAGGAAAATATGCGAAGTTCTCCAAACCCATTTATTACTGGCTTGACCAGGACAAATCCTTTCAGTGA
C
AGGACTGCTGCTCCTGGAAACCCATTTAGAGCCAAGTCTGAAGAATCAGAGGCAACTTCATGGTTCTCC
AAA
GAAGAGCCCGTTACTATCAGTCCTTTCCCTTCTCTGCAGCCTCTTGGTCATAACAAAAGCAGGGCTT
CA
TCTTCACTTGATGGCTTTAAGGACAGTTTTGATCTACAGGGCCAGTCTACATTAAAAATTAGCAACCC
G
AAAGGATGGGTAACCTTCGAGGAAGAAGAGGATTTTGGTGTGAAAGGGAAGTCAAAGTCAGCTTGTTCA
GAC
TTACTGGGTAATCAGCCAAGTTCATTTTCTGGCTCCAACCTGACATTGAATGATGACTGGAATAAAG
GT
ACAAATGTCTCCTTCTGTGTGTTGCCGTCAAGAAGACCTCCTCCACCTCCTGTCCCTCTGCTCCCGCC
C
GGCACCAGCCCTCCAGTAGATCCTTTCACGACCTTGGCCTCTAAGGCTTCACCCACACTGGACTTTACA
GAA
AGATAA


Translation (1612 aa):
MRKRWACWSGSDAPGGCGGGCGRRRRRSRRKRAASEERRMAFSKGFRIYHKLDPPPFSLIVETRHKEECL
M
FESGAVAVL
SSAEKEAIKGTYSKVLDAYGLLGVLRLNLGDTMLHYLVLVTGCMSVGKIQESEVFRVTST
E
FISLRIDSSDEDRISEVRKVLNSGNFYFAWSASGISLDLSLNAHRSMQEQTTDNRFF
WNQSLHLHLKHY
G
VNCDDWLLRLMCGGVEIRTIYAAHKQAKACLISRLSCERAGTRFNVRGTNDDGHVANFVETEQ
VVYLDD
S
VSSFIQIRGSVPLFWEQPGLQ
VGSHRVRMSRGFEANAPAFDRHFRTLKNLYGKQIIVNLLGSKEGEHML
S
KAFQ
SHLKASEHAADIQMVNFDYHQMVKGGKAEKLHSVLKPQVQKFLDYGFFYFNGSEVQRCQSGTVRT
N
CLDCLDRTNSVQAFLGLE
MLAKQLEALGLAEKPQLVTRFQEVFRSMWSVNGDSISKIYAGTGALEGKAK
L
KDGARSVTRTIQNNFFDSSKQEAIDVLLLGNTLNSDLADKARALLTTGSLR
VSEQTLQSASSKVLKSMC
E
NFYKYSKPKKIRVCVGTWNVNGGKQFRSIAFKNQTLTDWLLDAPKLAGIQEFQ
DKRSKPTDIFAIGFEE
M
VELNAGNIVSA
STTNQKLWAVELQKTISRDNKYVLLASEQLVGVCLFVFIRPQHAPFIRDVAVDTVKTG
M
GGATGNKGAVAIRMLFHTTSLCFVCSHFAAGQSQVKERNEDFIEIARKLSFPM
GRMLFSHDYVFWCGDF
N
YRIDLPNEEVKELIRQQNWDSLIAGDQLINQKNAGQ
VFRGFLEGKVTFAPTYKYDLFSDDYDTSEKCRT
P
AWTDRVLWRRRKWPFDRS
AEDLDLLNASFQDESKILYTWTPGTLLHYGRAELKTSDHRPVVALIDIDIF
E
VEAEERQNIYKEVIAVQGPPDGTVLVSIKSSLPENNFFDDALIDELLQQFASFGEVILI
RFVEDKMWVT
F
LEGSSALNVLSLNGKE
LLNRTITIALKSPDWIKNLEEEMSLEKISIALPSSTSSTLLGEDAEVAADFDM
E
GDVDDYSAEVEELLPQHLQPSSSSGLGTSPSSSPRTSPCQSPTISEGPVPSLPIRPSRAPSRTPGPPSA
Q
SSPIDAQPATPLPQKDPAQPLEPKRPPPPRPVAPPTRPAPPQRPPPPSGARSPAPTRKEFGGIGAPPSP
G
VARREME
APKSPGTTRKDNIGRSQPSPQAGLAGPGPAGYSTARPTIPPRAGVISAPQSHARASAGRLTP
E
SQSKTSETSK
GSTFLPEPLKPQAAFPPQSSLPPPAQRLQEPLVPVAAPMPQSGPQPNLETPPQPPPRSR
S
SHSLPSEASSQPQ
VKTNGISDGKRESPLKIDPFEDLSFNLLAVSKAQLSVQTSPVPTPDPKRLIQLPSA
T
QSNVLSSVSCMPTMPPIPARSQSQENMRSSPNPFITGLTRTNPFSDRTAAPGNPFRAKSEESEATSWFS
K
EEPVTISPFPSLQPLGHNKSRASSSLDGFKDSFDLQGQSTLKISNPKGWVTFEEEEDFGVKGKSKSACS
D
LLGNQPSSFSGSNLTLNDDWNKGTNVSFCVLPSRRPPPPPVPLLPPGTSPPVDPFTTLASKASPTLDFT
E
R




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser