NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS3343.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
3343.1 Public Homo sapiens 4 IDUA 22 109 92 CCDS HistoryNCBI Gene:3425Re-query CCDS DB by CCDS ID:3343.1Re-query CCDS DB by GeneID:3425See the combined annotation on chromosome 4 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 3343.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000247933.8 ENSP00000247933.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000247933.8Link to Ensembl Protein Viewer:ENSP00000247933.4Re-query CCDS DB by Nucleotide ID:ENST00000247933Re-query CCDS DB by Protein ID:ENSP00000247933
Original member NCBI NM_000203.4 NP_000194.2 Updated not alive Link to Nucleotide Sequence:NM_000203.4Link to Protein Sequence:NP_000194.2Re-query CCDS DB by Nucleotide ID:NM_000203Re-query CCDS DB by Protein ID:NP_000194
Current member NCBI NM_000203.5 NP_000194.2 Accepted alive Link to Nucleotide Sequence:NM_000203.5Link to Protein Sequence:NP_000194.2Re-query CCDS DB by Nucleotide ID:NM_000203Re-query CCDS DB by Protein ID:NP_000194Link to BLAST:NP_000194.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_000194.2 653 P35475-1 653 100% 0 0

Chromosomal Locations for CCDS 3343.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 4 (NC_000004.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4See the combined annotation on chromosome 4 in Sequence Viewer

Chromosome Start Stop Links
4 987085 987242 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 987809 987949 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 1000612 1000697 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 1000882 1000989 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 1001468 1001563 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 1001679 1001881 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 1001982 1002161 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 1002269 1002485 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 1002732 1002944 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 1003036 1003157 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 1003345 1003470 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 1003549 1003625 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 1004012 1004112 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 1004260 1004393 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1962 nt):
ATGCGTCCCCTGCGCCCCCGCGCCGCGCTGCTGGCGCTCCTGGCCTCGCTCCTGGCCGCGCCCCCGGTGG
CC
CCGGCCGAGGCCCCGCACCTGGTGCATGTGGACGCGGCCCGCGCGCTGTGGCCCCTGCGGCGCTTCTG
G
AGGAGCACAGGCTTCTGCCCCCCGCTGCCACACAGCCAGGCTGACCAGTACGTCCTCAGCTGGGACCAG
CAG
CTCAACCTCGCCTATGTGGGCGCCGTCCCTCACCGCGGCATCAAGCAGGTCCGGACCCACTGGCTGC
TG
GAGCTTGTCACCACCAGGGGGTCCACTGGACGGGGCCTGAGCTACAACTTCACCCACCTGGACGGGTA
C
CTGGACCTTCTCAGGGAGAACCAGCTCCTCCCAGGGTTTGAGCTGATGGGCAGCGCCTCGGGCCACTTC
ACT
GACTTTGAGGACAAGCAGCAGGTGTTTGAGTGGAAGGACTTGGTCTCCAGCCTGGCCAGGAGATACA
TC
GGTAGGTACGGACTGGCGCATGTTTCCAAGTGGAACTTCGAGACGTGGAATGAGCCAGACCACCACGA
C
TTTGACAACGTCTCCATGACCATGCAAGGCTTCCTGAACTACTACGATGCCTGCTCGGAGGGTCTGCGC
GCC
GCCAGCCCCGCCCTGCGGCTGGGAGGCCCCGGCGACTCCTTCCACACCCCACCGCGATCCCCGCTGA
GC
TGGGGCCTCCTGCGCCACTGCCACGACGGTACCAACTTCTTCACTGGGGAGGCGGGCGTGCGGCTGGA
C
TACATCTCCCTCCACAGGAAGGGTGCGCGCAGCTCCATCTCCATCCTGGAGCAGGAGAAGGTCGTCGCG
CAG
CAGATCCGGCAGCTCTTCCCCAAGTTCGCGGACACCCCCATTTACAACGACGAGGCGGACCCGCTGG
TG
GGCTGGTCCCTGCCACAGCCGTGGAGGGCGGACGTGACCTACGCGGCCATGGTGGTGAAGGTCATCGC
G
CAGCATCAGAACCTGCTACTGGCCAACACCACCTCCGCCTTCCCCTACGCGCTCCTGAGCAACGACAAT
GCC
TTCCTGAGCTACCACCCGCACCCCTTCGCGCAGCGCACGCTCACCGCGCGCTTCCAGGTCAACAACA
CC
CGCCCGCCGCACGTGCAGCTGTTGCGCAAGCCGGTGCTCACGGCCATGGGGCTGCTGGCGCTGCTGGA
T
GAGGAGCAGCTCTGGGCCGAAGTGTCGCAGGCCGGGACCGTCCTGGACAGCAACCACACGGTGGGCGTC
CTG
GCCAGCGCCCACCGCCCCCAGGGCCCGGCCGACGCCTGGCGCGCCGCGGTGCTGATCTACGCGAGCG
AC
GACACCCGCGCCCACCCCAACCGCAGCGTCGCGGTGACCCTGCGGCTGCGCGGGGTGCCCCCCGGCCC
G
GGCCTGGTCTACGTCACGCGCTACCTGGACAACGGGCTCTGCAGCCCCGACGGCGAGTGGCGGCGCCTG
GGC
CGGCCCGTCTTCCCCACGGCAGAGCAGTTCCGGCGCATGCGCGCGGCTGAGGACCCGGTGGCCGCGG
CG
CCCCGCCCCTTACCCGCCGGCGGCCGCCTGACCCTGCGCCCCGCGCTGCGGCTGCCGTCGCTTTTGCT
G
GTGCACGTGTGTGCGCGCCCCGAGAAGCCGCCCGGGCAGGTCACGCGGCTCCGCGCCCTGCCCCTGACC
CAA
GGGCAGCTGGTTCTGGTCTGGTCGGATGAACACGTGGGCTCCAAGTGCCTGTGGACATACGAGATCC
AG
TTCTCTCAGGACGGTAAGGCGTACACCCCGGTCAGCAGGAAGCCATCGACCTTCAACCTCTTTGTGTT
C
AGCCCAGACACAGGTGCTGTCTCTGGCTCCTACCGAGTTCGAGCCCTGGACTACTGGGCCCGACCAGGC
CCC
TTCTCGGACCCTGTGCCGTACCTGGAGGTCCCTGTGCCAAGAGGGCCCCCATCCCCGGGCAATCCAT
GA


Translation (653 aa):
MRPLRPRAALLALLASLLAAPPVAPAEAPHLVHVDAARALWPLRRFWRSTGFCPPLPHSQADQYVLSWDQ
Q
LNLAYVGAVPHRGIKQVRTHWLLELVTT
RGSTGRGLSYNFTHLDGYLDLLRENQLLPGFELMGSASGHF
T
DFEDKQQVFEWKDLVSSLARRYI
GRYGLAHVSKWNFETWNEPDHHDFDNVSMTMQGFLNYYDACSEGLR
A
ASPALRLGGPGDSFHTPPRSPLSWGLLRHCHDGTNFFTGEAGVRLDYISLHRK
GARSSISILEQEKVVA
Q
QIRQLFPKFADTPIYNDEADPLVGWSLPQPWRADVTYAAMVVK
VIAQHQNLLLANTTSAFPYALLSNDN
A
FLSYHPHPFAQRTLTARFQVNNTRPPHVQLLRKPVLTAMGLLALL
DEEQLWAEVSQAGTVLDSNHTVGV
L
ASAHRPQGPADAWRAAVLIYASDDTRAHPNRSVAVTLRLRGVPPGP
GLVYVTRYLDNGLCSPDGEWRRL
G
RPVFPTAEQFRRMRAAE
DPVAAAPRPLPAGGRLTLRPALRLPSLLLVHVCARPEKPPGQVTRLRALPLT
Q
GQLVLVWSDEHVGS
KCLWTYEIQFSQDGKAYTPVSRKPSTFNLFVFSPDTGAVSGSYRVRALDYWARPG
P
FSDPVPYLEVPVPRGPPSPGNP




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser