NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS33424.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
33424.1 Public Homo sapiens 2 FARP2 22 109 92 CCDS HistoryNCBI Gene:9855Re-query CCDS DB by CCDS ID:33424.1Re-query CCDS DB by GeneID:9855See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 3, NCBI annotation release 36.2, Ensembl annotation release 41

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 33424.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000264042.7 ENSP00000264042.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000264042.7Link to Ensembl Protein Viewer:ENSP00000264042.3Re-query CCDS DB by Nucleotide ID:ENST00000264042Re-query CCDS DB by Protein ID:ENSP00000264042
Original member NCBI NM_014808.3 NP_055623.1 Updated not alive Link to Nucleotide Sequence:NM_014808.3Link to Protein Sequence:NP_055623.1Re-query CCDS DB by Nucleotide ID:NM_014808Re-query CCDS DB by Protein ID:NP_055623
Current member NCBI NM_014808.4 NP_055623.1 Accepted alive Link to Nucleotide Sequence:NM_014808.4Link to Protein Sequence:NP_055623.1Re-query CCDS DB by Nucleotide ID:NM_014808Re-query CCDS DB by Protein ID:NP_055623Link to BLAST:NP_055623.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_055623.1 1054 O94887-1 1054 100% 0 0

Chromosomal Locations for CCDS 33424.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 2 (NC_000002.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 241373108 241373290 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 241403828 241403932 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 241404799 241404841 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 241407537 241407615 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 241411033 241411130 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 241413307 241413421 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 241417962 241418109 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 241431679 241431774 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 241434158 241434321 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 241434962 241435030 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 241436481 241436538 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 241441304 241441556 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 241456747 241456922 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 241462523 241462612 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 241463335 241463468 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 241463899 241463980 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 241468140 241468377 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 241475857 241475987 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 241483465 241483533 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 241484242 241484331 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 241489962 241490044 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 241491061 241491179 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 241491516 241491679 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 241492929 241493036 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 241493293 241493444 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 241494008 241494125 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3165 nt):
ATGGGGGAGATAGAAGGAACATACAGAGTCCTGCAGACTGCAGGGATGCGCTTGGGTGCCCAGACCCCTG
TG
GGAGTTAGCACCCTTGAGCCTGGGCAGACTCTCTTGCCCAGAATGCAAGAGAAGCACCTGCACCTCAG
A
GTAAAGCTGCTGGACAACACCATGGAAATATTTGACATTGAGCCTAAATGCGATGGCCAGGTATTACTG
ACA
CAAGTGTGGAAGCGTTTAAACCTGGTAGAATGTGACTACTTCGGGATGGAGTTTCAAAATACTCAGT
CC
TACTGGATTTGGCTTGAACCTATGAAACCCATCATTAGGCAAATACGAAGGCCAAAGAATGTGGTGCT
T
CGCCTAGCTGTAAAATTTTTTCCACCTGATCCTGGTCAGCTACAAGAAGAATATACAAGATACTTGTTT
GCC
TTGCAACTTAAGAGAGACCTGCTGGAAGAGCGTTTGACCTGTGCTGACACCACAGCGGCCCTTCTCA
CG
TCCCATCTCCTGCAGTCGGAAATAGGAGATTACGATGAAACGCTGGACCGAGAGCACCTCAAAGTGAA
C
GAGTATTTGCCTGGCCAGCAGCACTGCCTTGAGAAGATACTAGAATTCCATCAGAAGCACGTGGGCCAG
ACA
CCTGCTGAGTCGGATTTCCAGGTGCTCGAAATTGCTCGAAAGTTGGAAATGTACGGCATCAGATTTC
AC
ATGGCTTCTGACAGGGAAGGAACCAAGATTCAACTGGCAGTTTCCCACATGGGTGTACTCGTGTTCCA
G
GGCACCACCAAAATCAACACTTTCAACTGGTCCAAGGTCCGTAAACTAAGCTTCAAGAGGAAAAGATTT
CTT
ATCAAACTTCATCCAGAGGTTCATGGACCTTACCAGGACACATTAGAATTTTTGTTGGGTAGTAGAG
AT
GAATGTAAGAACTTCTGGAAGATTTGTGTGGAGTATCACACCTTTTTTAGACTTTTGGACCAACCTAA
G
CCAAAAGCAAAAGCCGTCTTCTTCAGCCGGGGCTCCTCCTTCAGATACAGTGGAAGAACTCAGAAACAA
CTA
GTAGATTATTTCAAAGACAGTGGAATGAAGAGAATTCCATATGAAAGAAGGCACAGCAAGACCCACA
CG
TCCGTTCGAGCTCTGACTGCAGACCTACCAAAACAGAGCATCTCATTCCCCGAGGGATTGAGGACTCC
T
GCCTCCCCATCTTCAGCGAATGCCTTTTACTCGCTCTCTCCCTCCACTCTGGTCCCCTCTGGCCTGCCA
GAG
TTTAAGGACAGCAGCAGCTCCCTCACAGATCCCCAGGTTTCCTACGTCAAGAGTCCAGCTGCAGAGA
GG
CGCAGTGGAGCAGTGGCTGGAGGCCCCGACACACCATCGGCCCAGCCCCTCGGGCCCCCCGCACTCCA
G
CCTGGTCCAGGCCTTTCCACGAAGAGTCCTCAGCCTTCTCCCTCCAGCCGGAAGAGCCCCCTGAGTCTG
AGC
CCTGCATTTCAGGTGCCTTTGGGCCCAGCTGAACAGGGCTCATCCCCACTCCTGAGCCCTGTCCTCA
GT
GATGCTGGCGGAGCCGGGATGGACTGCGAGGAGCCCAGACACAAGCGCGTGCCTGCAGACGAGGCCTA
C
TTCATAGTCAAAGAGATTCTCGCTACAGAACGAACATACCTCAAGGATTTAGAAGTTATTACCGTGTGG
TTC
CGCAGCGCAGTGGTGAAGGAGGACGCCATGCCTGCGACTCTGATGACGCTGCTCTTCTCCAACATCG
AT
CCCATCTATGAGTTCCACAGAGGCTTCCTGCGCGAGGTGGAGCAGAGGCTGGCACTCTGGGAAGGGCC
C
TCCAAAGCCCACACAAAAGGCAGTCATCAACGAATCGGGGACATCCTGCTCAGGAACATGCGCCAGTTA
AAG
GAGTTTACCAGCTACTTCCAAAGACATGACGAGGTCCTAACAGAACTGGAAAAGGCTACCAAACGCT
GT
AAGAAGTTGGAGGCAGTGTACAAGGAGTTTGAGCTGCAGAAGGTCTGCTACTTGCCTCTCAACACGTT
C
CTGCTGAAGCCCATCCAGCGGCTGCTGCACTACCGCCTGCTGCTGCGCCGCCTATGCGGACATTACAGC
CCC
GGGCACCATGACTACGCTGACTGCCATGACGCCCTGAAAGCCATCACAGAGGTGACCACCACACTAC
AG
CACATTCTCATCCGGCTGGAGAACCTGCAGAAGCTAACGGAGCTGCAGCGGGACCTGGTGGGCATAGA
G
AACCTCATTGCTCCTGGCAGGGAGTTCATCCGTGAGGGCTGCCTTCACAAGCTCACCAAGAAGGGCCTG
CAG
CAGAGGATGTTTTTTCTGTTCTCAGATATGTTGCTGTACACAAGCAAAGGAGTTGCAGGGACCAGCC
AC
TTCCGGATCCGGGGCCTCCTTCCCCTCCAAGGCATGCTGGTGGAAGAAAGTGATAACGAGTGGTCTGT
T
CCACACTGTTTCACCATCTACGCGGCTCAGAAAACAATCGTGGTGGCAGCCAGCACTCGGCTGGAGAAA
GAG
AAGTGGATGCTGGACCTGAACTCCGCGATCCAAGCAGCCAAGAGTGGCGGTGACACGGCCCCTGCAC
TG
CCAGGCCGCACTGTGTGCACTCGTCCCCCCAGATCCCCCAACGAGGTATCTCTGGAGCAGGAGTCAGA
A
GATGATGCTCGGGGTGTCCGCAGCTCCCTGGAGGGGCATGGCCAGCACCGGGCCAACACCACAATGCAC
GTG
TGCTGGTACCGGAACACCAGCGTGTCCAGGGCAGACCACAGTGCAGCTGTCGAGAACCAGCTTTCAG
GA
TATCTGCTAAGAAAGTTCAAAAACAGTCATGGCTGGCAGAAGCTCTGGGTCGTCTTTACCAACTTCTG
T
TTGTTCTTCTACAAAACTCATCAGGATGACTACCCACTGGCCAGCCTCCCGCTGCTGGGCTACAGCGTG
AGC
ATCCCCAGGGAGGCCGATGGCATACACAAAGACTATGTTTTCAAGCTCCAGTTCAAATCCCACGTCT
AC
TTCTTCCGGGCTGAGAGCAAGTACACATTTGAAAGGTGGATGGAGGTGATCCAGGGGGCCAGCAGCTC
A
GCCGGGAGGGCCCCAAGCATCGTGCAGGATGGCCCCCAACCCTCCTCAGGGCTGGAGGGGATGGTCAGG
GGG
AAGGAGGAATGA


Translation (1054 aa):
MGEIEGTYRVLQTAGMRLGAQTPVGVSTLEPGQTLLPRMQEKHLHLRVKLLDNTMEIFDIEPKCDGQVLL
T
QVWKRLNLVECDYFGMEFQNTQSYW
IWLEPMKPIIRQIRRPKNVVLRLAVKFFPPDPGQLQEEYTRYLF
A
LQLKRDLLEERLTCADTTAALLTSHLLQ
SEIGDYDETLDREHLKVNEYLPGQQHCLEKILEFHQKHVGQ
T
PAESDFQVLEIARKLEMYGIRFHMASDREGTKIQLAVSHMGVLVFQ
GTTKINTFNWSKVRKLSFKRKRF
L
IKLHPEVH
GPYQDTLEFLLGSRDECKNFWKICVEYHTFFRLLDQPKPKAKAVFFSRGSSFRYSGRTQKQ
L
VDYFKDSGMKRIPYE
RRHSKTHTSVRALTADLPKQSISFPEGLRTPASPSSANAFYSLSPSTLVPSGLP
E
FKDSSSSLTDPQVSYVKSPAAERRSGAVAGGPDTPSAQPLGPPALQPGP
GLSTKSPQPSPSSRKSPLSL
S
PAFQVPLGPAEQGSSPLLSPVLSDAGGAGMDCEEPRHK
RVPADEAYFIVKEILATERTYLKDLEVITVW
F
RSAVVKEDAMPATLMTLLFSNIDPIYEFHRGFLREVEQRLAL
WEGPSKAHTKGSHQRIGDILLRNMRQL
K
EFTSYFQRHDEVLTELEKATKRCKKLEAVYKEFELQKVCYLPLNTFLLKPIQRLLHYRLLLRRLCGHYS
P
GHHDYADCH
DALKAITEVTTTLQHILIRLENLQKLTELQRDLVGIENLIAPGREFIREGCLHKLTKKGL
Q
QRMFFL
FSDMLLYTSKGVAGTSHFRIRGLLPLQGMLVEESDNEWSVPHCFTIYAAQKTIVVAASTRLEK
E
KWMLDLNSAIQAAKSGGDTAPALPGRTVCTRPP
RSPNEVSLEQESEDDARGVRSSLEGHGQHRANTTMH
V
CWYRNTSVSRADHSAAVE
NQLSGYLLRKFKNSHGWQKLWVVFTNFCLFFYKTHQDDYPLASLPLLGYSV
S
IPREADGIHKDYVFKLQFKSHVYFFRAESKYTFE
RWMEVIQGASSSAGRAPSIVQDGPQPSSGLEGMVR
G
KEE




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser