NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS33164.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
33164.1 Public Homo sapiens 2 EIF2B4 22 109 92 CCDS HistoryNCBI Gene:8890Re-query CCDS DB by CCDS ID:33164.1Re-query CCDS DB by GeneID:8890See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 3, NCBI annotation release 36.2, Ensembl annotation release 41

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 33164.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000347454.8 ENSP00000233552.5 Accepted alive Link to Ensembl Transcript Viewer:ENST00000347454.8Link to Ensembl Protein Viewer:ENSP00000233552.5Re-query CCDS DB by Nucleotide ID:ENST00000347454Re-query CCDS DB by Protein ID:ENSP00000233552
Original member Current member NCBI NM_001034116.1 NP_001029288.1 Accepted alive Link to Nucleotide Sequence:NM_001034116.1Link to Protein Sequence:NP_001029288.1Re-query CCDS DB by Nucleotide ID:NM_001034116Re-query CCDS DB by Protein ID:NP_001029288Link to BLAST:NP_001029288.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001029288.1 523 Q9UI10-1 523 100% 0 0

Chromosomal Locations for CCDS 33164.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 2 (NC_000002.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 27364400 27364599 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27364718 27364898 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27366759 27366936 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27367074 27367201 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27367457 27367559 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27367746 27367822 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27368025 27368139 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27368372 27368463 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27368654 27368733 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27369006 27369212 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27369414 27369549 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27369876 27369919 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27370284 27370314 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1572 nt):
ATGGCTGCTGTGGCCGTGGCTGTTCGCGAGGACTCGGGATCCGGGATGAAGGCGGAGCTTCCCCCTGGGC
CT
GGGGCAGTGGGGAGGGAAATGACCAAAGAAGAAAAGCTGCAGCTTCGGAAGGAAAAGAAACAGCAGAA
G
AAGAAACGGAAGGAAGAAAAGGGGGCAGAACCAGAGACTGGCTCTGCTGTATCTGCAGCCCAATGTCAA
G
TA
GGCCCAACCAGAGAACTGCCAGAATCGGGCATTCAGTTGGGCACTCCTCGGGAGAAAGTTCCAGCTG
GT
CGGAGTAAGGCCGAACTTCGGGCTGAGCGTCGAGCCAAGCAGGAGGCCGAGCGGGCCCTGAAACAGGC
A
AGAAAAGGGGAACAAGGAGGACCACCTCCTAAGGCCAGCCCCAGCACAGCTGGAGAAACCCCCTCAGGA
GTG
AAGCGTCTCCCTGAGTACCCTCAGGTTGATGACCTACTTCTGAGAAGGCTTGTTAAAAAACCAGAGC
GT
CAACAGGTTCCTACACGAAAGGATTATGGATCCAAAGTCAGTCTCTTCTCTCACCTACCCCAGTACAG
C
AGACAAAACTCTCTGACCCAGTTTATGAGCATCCCATCCTCTGTGATCCACCCAGCCATGGTGCGACTC
GGC
CTGCAGTACTCCCAGGGCCTGGTCAGTGGCTCCAATGCCCGGTGTATTGCCCTGCTTCGTGCCTTGC
AG
CAGGTGATTCAGGATTACACAACACCGCCTAATGAAGAACTCTCCAGGGATCTAGTGAATAAACTAAA
A
CCCTACATGAGCTTCCTGACTCAGTGCCGTCCCCTGTCAGCGAGCATGCACAACGCCATCAAGTTCCTT
AAC
AAGGAAATCACCAGTGTGGGCAGTTCCAAGCGGGAAGAGGAGGCCAAGTCAGAACTTCGAGCAGCCA
TT
GATCGGTATGTGCAAGAGAAGATTGTGCTAGCAGCTCAGGCAATTTCACGCTTTGCTTACCAGAAGAT
C
AGTAATGGAGATGTGATCCTGGTATATGGATGCTCATCTCTGGTATCACGAATTCTTCAGGAGGCTTGG
ACA
GAGGGCCGGCGGTTTCGGGTGGTAGTGGTGGACAGCCGGCCATGGCTGGAAGGAAGGCACACACTAC
GT
TCTCTAGTCCATGCTGGTGTCCCAGCCTCCTACCTGCTGATTCCTGCAGCCTCCTATGTGCTCCCAGA
G
GTTTCCAAGGTGCTATTGGGAGCTCATGCACTCTTGGCCAACGGGTCTGTGATGTCACGGGTAGGGACA
GCA
CAGTTAGCCCTGGTGGCTCGAGCCCATAATGTACCAGTGCTGGTTTGCTGTGAAACATACAAGTTCT
GT
GAGCGTGTGCAGACTGATGCCTTTGTCTCTAATGAGCTAGATGACCCTGATGATCTGCAATGTAAGCG
G
GGAGAACATGTTGCGCTGGCTAACTGGCAGAACCACGCATCCCTACGGTTGTTGAATCTAGTCTATGAT
GTG
ACTCCCCCAGAGCTTGTGGATCTGGTGATCACGGAGCTGGGGATGATCCCTTGCAGTTCTGTACCTG
TT
GTTCTACGAGTCAAGAGCAGTGACCAGTGA


Translation (523 aa):
MAAVAVAVREDSGSGMKAELPPGPGAVGREMTKEEKLQLRKEKKQQKKKRKEEKGAEPETGSAVSAAQCQ
V
GPTRELPESGIQLGTPREKVPAGRSKAELRAERRAKQEAERALKQARKGEQGGPPPKASPSTAGETPSG
V
KRLPEYPQVDDLLLRRLVKKPERQQ
VPTRKDYGSKVSLFSHLPQYSRQNSLTQFMSIPSSVIHPAMVRL
G
LQYSQGLVSGSNARCIALLRALQQ
VIQDYTTPPNEELSRDLVNKLKPYMSFLTQCRPLSASMHNAIKFL
N
KEITSVGSSKREEE
AKSELRAAIDRYVQEKIVLAAQAISRFAYQKISNGDVILVYGCSSLVSRILQEAW
T
EGRRFRVVVVDSRPWLEGRHTLRSLVHAGVPASYLLIPAASYVLPE
VSKVLLGAHALLANGSVMSRVGT
A
QLALVARAHNVPVLVCCETYKFCERVQTDAFVSNEL
DDPDDLQCKRGEHVALANWQNHASLRLLNLVYD
V
TPPELVDLVITELGMIPCSSVPVVLRVKSSDQ




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser