NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
The CCDS database will be unavailable on Thursday, April 25, 2024, starting at 7:00 a.m. EDT for up to 120 minutes.
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS3315.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
3315.1 Public Homo sapiens 3 PCYT1A 24 110 108 CCDS HistoryNCBI Gene:5130Re-query CCDS DB by CCDS ID:3315.1Re-query CCDS DB by GeneID:5130See the combined annotation on chromosome 3 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 3315.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000292823.6 ENSP00000292823.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000292823.6Link to Ensembl Protein Viewer:ENSP00000292823.2Re-query CCDS DB by Nucleotide ID:ENST00000292823Re-query CCDS DB by Protein ID:ENSP00000292823
Original member Current member EBI ENST00000431016.6 ENSP00000394617.1 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000431016.6Link to Ensembl Protein Viewer:ENSP00000394617.1Re-query CCDS DB by Nucleotide ID:ENST00000431016Re-query CCDS DB by Protein ID:ENSP00000394617
Original member Current member NCBI NM_001312673.2 NP_001299602.1 MANE Select Accepted alive Link to Nucleotide Sequence:NM_001312673.2Link to Protein Sequence:NP_001299602.1Re-query CCDS DB by Nucleotide ID:NM_001312673Re-query CCDS DB by Protein ID:NP_001299602Link to BLAST:NP_001299602.1
Original member Current member NCBI NM_005017.4 NP_005008.2 Accepted alive Link to Nucleotide Sequence:NM_005017.4Link to Protein Sequence:NP_005008.2Re-query CCDS DB by Nucleotide ID:NM_005017Re-query CCDS DB by Protein ID:NP_005008Link to BLAST:NP_005008.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001299602.1 367 P49585 367 100% 0 0
NP_005008.2 367 P49585 367 100% 0 0

Chromosomal Locations for CCDS 3315.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '-' strand of Chromosome 3 (NC_000003.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3See the combined annotation on chromosome 3 in Sequence Viewer

Chromosome Start Stop Links
3 196238688 196238894 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 196239547 196239735 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 196241948 196242090 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 196242562 196242640 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 196247367 196247518 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 196248207 196248323 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 196257788 196257887 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 196270415 196270531 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1104 nt):
ATGGATGCACAGTGTTCAGCCAAGGTCAATGCAAGGAAGAGGAGAAAAGAGGCGCCCGGACCCAACGGGG
CA
ACAGAAGAAGATGGGGTTCCTTCCAAAGTGCAGCGCTGTGCAGTGGGCTTACGGCAACCAGCTCCTTT
T
TCTGATGAAATTGAAGTTGACTTTAGTAAGCCCTATGTCAGGGTAACTATGGAAGAAGCCAGCAGAGGA
ACT
CCTTGTGAGCGACCTGTGAGAGTTTATGCCGATGGAATATTTGACTTATTTCACTCTGGTCACGCCC
GA
GCTCTGATGCAAGCGAAGAACCTTTTCCCTAATACGTACCTCATTGTGGGAGTTTGCAGTGATGAGCT
C
ACACACAACTTCAAAGGCTTCACGGTGATGAACGAGAATGAGCGCTATGACGCAGTCCAGCACTGCCGC
TAC
GTGGATGAGGTGGTGAGGAATGCGCCCTGGACGCTGACACCCGAGTTCCTGGCCGAACACCGGATTG
AT
TTTGTAGCCCATGATGATATTCCTTATTCATCTGCTGGCAGTGATGATGTTTATAAGCACATCAAGGA
G
GCAGGCATGTTTGCTCCAACACAGAGGACAGAAGGTATCTCCACATCAGACATCATCACCCGAATTGTG
CGG
GATTATGATGTGTATGCGAGGCGGAACCTGCAGAGGGGCTACACAGCAAAGGAGCTCAATGTCAGCT
TT
ATCAACGAGAAGAAATACCACTTGCAGGAGAGGGTTGACAAAGTAAAGAAGAAAGTGAAAGATGTGGA
G
GAAAAGTCAAAAGAATTTGTTCAGAAGGTGGAGGAAAAAAGCATTGACCTCATTCAGAAGTGGGAGGAG
AAG
TCCCGAGAATTCATTGGAAGTTTTCTGGAAATGTTTGGTCCGGAAGGAGCACTGAAACATATGCTGA
AA
GAGGGGAAGGGCCGGATGCTGCAGGCCATCAGCCCGAAGCAGAGCCCCAGCAGCAGCCCTACTCGCGA
G
CGCTCCCCCTCCCCCTCTTTCCGATGGCCCTTCTCCGGCAAGACTTCCCCACCTTGCTCCCCAGCAAAT
CTC
TCCAGGCACAAGGCTGCAGCCTATGATATCAGTGAGGATGAAGAAGACTAA


Translation (367 aa):
MDAQCSAKVNARKRRKEAPGPNGATEEDGVPSKVQRCAVGLRQPAPFSDEIEVDFSKPYVRVTMEEASRG
T
P
CERPVRVYADGIFDLFHSGHARALMQAKNLFPNTYLIVGVCSDELTHNFKGFTVMNENERYDAVQHCR
Y
VDEVVRNAPWTLTPEFLAEHR
IDFVAHDDIPYSSAGSDDVYKHIKEAGMFAPTQRTEGISTSDIITRIV
R
DYDVYARRNLQRGYTAKELNVSFIN
EKKYHLQERVDKVKKKVKDVEEKSKEFVQKVEEKSIDLIQKWEE
K
SREFIGSFLEMFGPEGAL
KHMLKEGKGRMLQAISPKQSPSSSPTRERSPSPSFRWPFSGKTSPPCSPAN
L
SRHKAAAYDISEDEED




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser