NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS32905.3 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
32905.3 Public Homo sapiens 19 FDX2 24 110 108 CCDS HistoryNCBI Gene:112812Re-query CCDS DB by CCDS ID:32905.3Re-query CCDS DB by GeneID:112812See the combined annotation on chromosome 19 in Sequence Viewer

Public Note for CCDS 32905.1
The coding region has been updated to extend the N-terminus to one that is more supported by the available transcript and conservation data.

Public since: CCDS release 3, NCBI annotation release 36.2, Ensembl annotation release 41

Review status: Reviewed (by RefSeq, Havana and CCDS collaboration)


Attributes
CDS uses downstream AUG

Sequence IDs included in CCDS 32905.3

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000393708.3 ENSP00000377311.5 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000393708.3Link to Ensembl Protein Viewer:ENSP00000377311.5Re-query CCDS DB by Nucleotide ID:ENST00000393708Re-query CCDS DB by Protein ID:ENSP00000377311
Original member Current member NCBI NM_001397406.1 NP_001384335.1 MANE Select Accepted alive Link to Nucleotide Sequence:NM_001397406.1Link to Protein Sequence:NP_001384335.1Re-query CCDS DB by Nucleotide ID:NM_001397406Re-query CCDS DB by Protein ID:NP_001384335Link to BLAST:NP_001384335.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001384335.1 183 Q6P4F2-1 183 100% 0 0

Chromosomal Locations for CCDS 32905.3

Assembly GRCh38.p14 (GCF_000001405.40)

On '-' strand of Chromosome 19 (NC_000019.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19See the combined annotation on chromosome 19 in Sequence Viewer

Chromosome Start Stop Links
19 10310486 10310642 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 10310853 10310940 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 10315386 10315492 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 10315705 10315759 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 10315852 10315996 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (552 nt):
ATGGCCGCCTCCATGGCCCGGGGAGGCGTGAGTGCCAGGGTTCTACTGCAGGCTGCCAGGGGCACCTGGT
GG
AACAGACCTGGGGGCACTTCCGGGTCGGGGGAGGGGGTGGCGCTGGGGACAACCAGAAAGTTTCAAGC
G
ACAGGCTCGCGCCCGGCTGGAGAGGAGGACGCGGGCGGCCCGGAGCGGCCCGGGGACGTGGTGAACGTG
GTG
TTCGTAGACCGCTCAGGCCAGCGGATCCCAGTGAGTGGCAGAGTCGGGGACAATGTTCTTCACCTGG
CC
CAGCGCCACGGGGTGGACCTGGAAGGGGCCTGTGAAGCCTCCCTGGCCTGCTCCACCTGCCATGTGTA
T
GTGAGTGAAGACCACCTGGATCTCCTGCCTCCTCCCGAGGAGAGGGAAGACGACATGCTAGACATGGCC
CCC
CTCCTCCAGGAGAACTCGCGGCTGGGCTGCCAGATTGTGCTGACACCGGAGCTGGAAGGAGCGGAAT
TC
ACCCTGCCCAAGATCACCAGGAACTTCTACGTGGATGGCCATGTCCCCAAGCCCCACTGA


Translation (183 aa):
MAASMARGGVSARVLLQAARGTWWNRPGGTSGSGEGVALGTTRKFQATGSRPAGEEDAGGPERPGDVVNV
V
FVDRSGQRIPVSGRVGDNVLHLAQRHGVDLE
GACEASLACSTCHVYVSEDHLDLLPPPEEREDDMLDMA
P
LLQENSRLGCQIVLTPELEGAEFTLPKITRNFYVDGHVPKPH




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser