NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS3282.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
3282.1 Public Homo sapiens 3 EIF4A2 22 109 92 CCDS HistoryNCBI Gene:1974Re-query CCDS DB by CCDS ID:3282.1Re-query CCDS DB by GeneID:1974See the combined annotation on chromosome 3 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 3282.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000323963.9 ENSP00000326381.5 Accepted alive Link to Ensembl Transcript Viewer:ENST00000323963.9Link to Ensembl Protein Viewer:ENSP00000326381.5Re-query CCDS DB by Nucleotide ID:ENST00000323963Re-query CCDS DB by Protein ID:ENSP00000326381
Original member NCBI NM_001967.3 NP_001958.2 Updated not alive Link to Nucleotide Sequence:NM_001967.3Link to Protein Sequence:NP_001958.2Re-query CCDS DB by Nucleotide ID:NM_001967Re-query CCDS DB by Protein ID:NP_001958
Current member NCBI NM_001967.4 NP_001958.2 Accepted alive Link to Nucleotide Sequence:NM_001967.4Link to Protein Sequence:NP_001958.2Re-query CCDS DB by Nucleotide ID:NM_001967Re-query CCDS DB by Protein ID:NP_001958Link to BLAST:NP_001958.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001958.2 407 Q14240-1 407 100% 0 0

Chromosomal Locations for CCDS 3282.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 3 (NC_000003.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3See the combined annotation on chromosome 3 in Sequence Viewer

Chromosome Start Stop Links
3 186783611 186783639 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 186784432 186784477 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 186784564 186784696 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 186784962 186785101 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 186785883 186786051 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 186786164 186786273 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 186786502 186786645 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 186787127 186787264 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 186787495 186787584 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 186787803 186787882 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 186789125 186789269 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1224 nt):
ATGTCTGGTGGCTCCGCGGATTATAACAGAGAACATGGCGGCCCAGAGGGAATGGACCCCGATGGTGTCA
TC
GAGAGCAACTGGAATGAGATTGTTGATAACTTTGATGATATGAATTTAAAGGAGTCTCTCCTTCGTGG
C
ATCTATGCTTACGGTTTTGAGAAGCCTTCCGCTATTCAGCAGAGAGCTATTATTCCCTGTATTAAAGGG
TAT
GATGTGATTGCTCAAGCTCAGTCAGGTACTGGCAAGACAGCCACATTTGCTATTTCCATCCTGCAAC
AG
TTGGAGATTGAGTTCAAGGAGACCCAAGCACTAGTATTGGCCCCCACCAGAGAACTGGCTCAACAGAT
C
CAAAAGGTAATTCTGGCACTTGGAGACTATATGGGAGCCACTTGTCATGCCTGCATTGGTGGAACAAAT
GTT
CGAAATGAAATGCAAAAACTGCAGGCTGAAGCACCACATATTGTTGTTGGTACACCCGGGAGAGTGT
TT
GATATGTTAAACAGAAGATACCTTTCTCCAAAATGGATCAAAATGTTTGTTTTGGATGAAGCAGATGA
A
ATGTTGAGCCGTGGTTTTAAGGATCAAATCTATGAGATTTTCCAAAAACTAAACACAAGTATTCAGGTT
GTG
TTGCTTTCTGCCACAATGCCAACTGATGTGTTGGAAGTGACCAAAAAATTCATGAGAGATCCAATTC
GA
ATTCTGGTGAAAAAGGAAGAATTGACCCTTGAAGGAATCAAACAGTTTTATATTAATGTTGAGAGAGA
G
GAATGGAAGTTGGATACACTTTGTGACTTGTACGAGACACTGACCATTACACAGGCTGTTATTTTTCTC
AAT
ACGAGGCGCAAGGTGGACTGGCTGACTGAGAAGATGCATGCCAGAGACTTCACAGTTTCTGCTCTGC
AT
GGTGACATGGACCAGAAGGAGAGAGATGTTATCATGAGGGAATTCCGGTCAGGGTCAAGTCGTGTTCT
G
ATCACTACTGACTTGTTGGCTCGCGGGATTGATGTGCAACAAGTGTCTTTGGTTATAAATTATGATCTA
CCT
ACCAATCGTGAAAACTATATTCACAGAATTGGCAGAGGGGGTCGATTTGGGAGGAAAGGTGTGGCTA
TA
AACTTTGTTACTGAAGAAGACAAGAGGATTCTTCGTGACATTGAGACTTTCTACAATACTACAGTGGA
G
GAGATGCCCATGAATGTGGCTGACCTTATTTAA


Translation (407 aa):
MSGGSADYNREHGGPEGMDPDGVIESNWNEIVDNFDDMNLKESLLRGIYAYGFEKPSAIQQRAIIPCIKG
Y
DVIAQAQSGTGKTATFAISILQQLEIEFKETQALVLAPTRELAQQ
IQKVILALGDYMGATCHACIGGTN
V
RNEMQKLQAEAPHIVVGTPGRVFDMLNRRYL
SPKWIKMFVLDEADEMLSRGFKDQIYEIFQKLNTSIQV
V
LLSATMPTDVLEVTKKFMRDPIRILVKKEELTLEGIKQFYINVERE
EWKLDTLCDLYETLTITQAVIFL
N
TRRKVDWLTEKMHARDFTVSAL
HGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDL
P
TNRENYIH
RIGRGGRFGRKGVAINFVTEEDKRILRDIETFYNTTVEEMPMNVADLI



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser