NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS32663.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
32663.1 Public Homo sapiens 17 HDAC5 22 109 92 CCDS HistoryNCBI Gene:10014Re-query CCDS DB by CCDS ID:32663.1Re-query CCDS DB by GeneID:10014See the combined annotation on chromosome 17 in Sequence Viewer

Public since: CCDS release 3, NCBI annotation release 36.2, Ensembl annotation release 41

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 32663.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000225983.10 ENSP00000225983.5 Accepted alive Link to Ensembl Transcript Viewer:ENST00000225983.10Link to Ensembl Protein Viewer:ENSP00000225983.5Re-query CCDS DB by Nucleotide ID:ENST00000225983Re-query CCDS DB by Protein ID:ENSP00000225983
Original member Current member NCBI NM_001015053.1 NP_001015053.1 Accepted alive Link to Nucleotide Sequence:NM_001015053.1Link to Protein Sequence:NP_001015053.1Re-query CCDS DB by Nucleotide ID:NM_001015053Re-query CCDS DB by Protein ID:NP_001015053Link to BLAST:NP_001015053.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001015053.1 1123 Q9UQL6-3 1123 100% 0 0

Chromosomal Locations for CCDS 32663.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 17 (NC_000017.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17See the combined annotation on chromosome 17 in Sequence Viewer

Chromosome Start Stop Links
17 44078376 44078415 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 44078500 44078665 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 44078795 44078879 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 44079144 44079277 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 44080107 44080225 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 44080401 44080498 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 44080763 44080882 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 44082585 44082672 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 44082765 44082820 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 44083545 44083652 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 44083805 44083854 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 44084555 44084675 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 44085022 44085155 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 44086572 44086737 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 44087412 44087696 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 44088387 44088598 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 44091270 44091492 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 44091700 44091831 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 44092172 44092284 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 44092381 44092527 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 44092676 44092806 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 44093092 44093206 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 44093314 44093485 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 44093575 44093834 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 44110729 44110803 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 44117494 44117515 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3372 nt):
ATGAACTCTCCCAACGAGTCGGCAGATGGGATGTCAGGTCGGGAACCATCCTTGGAAATCCTGCCGCGGA
CT
TCTCTGCACAGCATCCCTGTGACAGTGGAGGTGAAGCCGGTGCTGCCAAGAGCCATGCCCAGTTCCAT
G
GGGGGTGGGGGTGGAGGCAGCCCCAGCCCTGTGGAGCTACGGGGGGCTCTGGTGGGCTCTGTGGACCCC
ACA
CTGCGGGAGCAGCAACTGCAGCAGGAGCTCCTGGCGCTCAAGCAGCAGCAGCAGCTGCAGAAGCAGC
TC
CTGTTCGCTGAGTTCCAGAAACAGCATGACCACCTGACAAGGCAGCATGAGGTCCAGCTGCAGAAGCA
C
CTCAAGCAGCAGCAGGAGATGCTGGCAGCCAAGCAGCAGCAGGAGATGCTGGCAGCCAAGCGGCAGCAG
GAG
CTGGAGCAGCAGCGGCAGCGGGAGCAGCAGCGGCAGGAAGAGCTGGAGAAGCAGCGGCTGGAGCAGC
AG
CTGCTCATCCTGCGGAACAAGGAGAAGAGCAAAGAGAGTGCCATTGCCAGCACTGAGGTAAAGCTGAG
G
CTCCAGGAATTCCTCTTGTCGAAGTCAAAGGAGCCCACACCAGGCGGCCTCAACCATTCCCTCCCACAG
CAC
CCCAAATGCTGGGGAGCCCACCATGCTTCTTTGGACCAGAGTTCCCCTCCCCAGAGCGGCCCCCCTG
GG
ACGCCTCCCTCCTACAAACTGCCTTTGCCTGGGCCCTACGACAGTCGAGACGACTTCCCCCTCCGCAA
A
ACAGCCTCTGAACCCAACTTGAAAGTGCGTTCAAGGCTAAAACAGAAGGTGGCTGAGCGGAGAAGCAGT
CCC
CTCCTGCGTCGCAAGGATGGGACTGTTATTAGCACCTTTAAGAAGAGAGCTGTTGAGATCACAGGTG
CC
GGGCCTGGGGCGTCGTCCGTGTGTAACAGCGCACCCGGCTCCGGCCCCAGCTCTCCCAACAGCTCCCA
C
AGCACCATCGCTGAGAATGGCTTTACTGGCTCAGTCCCCAACATCCCCACTGAGATGCTCCCTCAGCAC
CGA
GCCCTCCCTCTGGACAGCTCCCCCAACCAGTTCAGCCTCTACACGTCTCCTTCTCTGCCCAACATCT
CC
CTAGGGCTGCAGGCCACGGTCACTGTCACCAACTCACACCTCACTGCCTCCCCGAAGCTGTCGACACA
G
CAGGAGGCCGAGAGGCAGGCCCTCCAGTCCCTGCGGCAGGGTGGCACGCTGACCGGCAAGTTCATGAGC
ACA
TCCTCTATTCCTGGCTGCCTGCTGGGCGTGGCACTGGAGGGCGACGGGAGCCCCCACGGGCATGCCT
CC
CTGCTGCAGCATGTGCTGTTGCTGGAGCAGGCCCGGCAGCAGAGCACCCTCATTGCTGTGCCACTCCA
C
GGGCAGTCCCCACTAGTGACGGGTGAACGTGTGGCCACCAGCATGCGGACGGTAGGCAAGCTCCCGCGG
CAT
CGGCCCCTGAGCCGCACTCAGTCCTCACCGCTGCCGCAGAGTCCCCAGGCCCTGCAGCAGCTGGTCA
TG
CAACAACAGCACCAGCAGTTCCTGGAGAAGCAGAAGCAGCAGCAGCTACAGCTGGGCAAGATCCTCAC
C
AAGACAGGGGAGCTGCCCAGGCAGCCCACCACCCACCCTGAGGAGACAGAGGAGGAGCTGACGGAGCAG
CAG
GAGGTCTTGCTGGGGGAGGGAGCCCTGACCATGCCCCGGGAGGGCTCCACAGAGAGTGAGAGCACAC
AG
GAAGACCTGGAGGAGGAGGACGAGGAAGACGATGGGGAGGAGGAGGAGGATTGCATCCAGGTTAAGGA
C
GAGGAGGGCGAGAGTGGTGCTGAGGAGGGGCCCGACTTGGAGGAGCCTGGTGCTGGATACAAAAAACTG
TTC
TCAGATGCCCAGCCGCTGCAGCCTTTGCAGGTGTACCAGGCGCCCCTCAGCCTGGCCACTGTGCCCC
AC
CAGGCCCTGGGCCGTACCCAGTCCTCCCCTGCTGCCCCTGGGGGCATGAAGAGCCCCCCAGACCAGCC
C
GTCAAGCACCTCTTCACCACAGGTGTGGTCTACGACACGTTCATGCTAAAGCACCAGTGCATGTGCGGG
AAC
ACACACGTGCACCCTGAGCATGCTGGCCGGATCCAGAGCATCTGGTCCCGGCTGCAGGAGACAGGCC
TG
CTTAGCAAGTGCGAGCGGATCCGAGGTCGCAAAGCCACGCTAGATGAGATCCAGACAGTGCACTCTGA
A
TACCACACCCTGCTCTATGGGACCAGTCCCCTCAACCGGCAGAAGCTAGACAGCAAGAAGTTGCTCGGC
CCC
ATCAGCCAGAAGATGTATGCTGTGCTGCCTTGTGGGGGCATCGGGGTGGACAGTGACACCGTGTGGA
AT
GAGATGCACTCCTCCAGTGCTGTGCGCATGGCAGTGGGCTGCCTGCTGGAGCTGGCCTTCAAGGTGGC
T
GCAGGAGAGCTCAAGAATGGATTTGCCATCATCCGGCCCCCAGGACACCACGCCGAGGAATCCACAGCC
AT
G
GGATTCTGCTTCTTCAACTCTGTAGCCATCACCGCAAAACTCCTACAGCAGAAGTTGAACGTGGGCA
AG
GTCCTCATCGTGGACTGGGACATTCACCATGGCAATGGCACCCAGCAGGCGTTCTACAATGACCCCTC
T
GTGCTCTACATCTCTCTGCATCGCTATGACAACGGGAACTTCTTTCCAGGCTCTGGGGCTCCTGAAGAG
GTT
GGTGGAGGACCAGGCGTGGGGTACAATGTGAACGTGGCATGGACAGGAGGTGTGGACCCCCCCATTG
GA
GACGTGGAGTACCTTACAGCCTTCAGGACAGTGGTGATGCCCATTGCCCACGAGTTCTCACCTGATGT
G
GTCCTAGTCTCCGCCGGGTTTGATGCTGTTGAAGGACATCTGTCTCCTCTGGGTGGCTACTCTGTCACC
GCC
AGATGTTTTGGCCACTTGACCAGGCAGCTGATGACCCTGGCAGGGGGCCGGGTGGTGCTGGCCCTGG
AG
GGAGGCCATGACTTGACCGCCATCTGTGATGCCTCTGAGGCTTGTGTCTCGGCTCTGCTCAGTGTAGA
G
CTGCAGCCCTTGGATGAGGCAGTCTTGCAGCAAAAGCCCAACATCAACGCAGTGGCCACGCTAGAGAAA
GTC
ATCGAGATCCAGAGCAAACACTGGAGCTGTGTGCAGAAGTTCGCCGCTGGTCTGGGCCGGTCCCTGC
GA
GAGGCCCAAGCAGGTGAGACCGAGGAGGCCGAGACTGTGAGCGCCATGGCCTTGCTGTCGGTGGGGGC
C
GAGCAGGCCCAGGCTGCGGCAGCCCGGGAACACAGCCCCAGGCCGGCAGAGGAGCCCATGGAGCAGGAG
CCT
GCCCTGTGA


Translation (1123 aa):
MNSPNESADGMSGREPSLEILPRTSLHSIPVTVEVKPVLPRAMPSSMGGGGGGSPSPVELRGALVGSVDP
T
LREQQLQQELLALKQQQQLQKQLLFAEFQKQHDHLTRQHEVQLQKHLK
QQQEMLAAKQQQEMLAAKRQQ
E
LEQQRQREQQRQEELEKQRLEQQLLILRNKEKSKE
SAIASTEVKLRLQEFLLSKSKEPTPGGLNHSLPQ
H
PKC
WGAHHASLDQSSPPQSGPPGTPPSYKLPLPGPYDSRDDFPLRKTASEPNLKVRSRLKQKVAERRSS
P
LLRRKDGTVISTFKKRAVEITGAGPG
ASSVCNSAPGSGPSSPNSSHSTIAENGFTGSVPNIPTEMLPQH
R
ALPLDSSPNQFSLYTSPSLPNISLGLQATVTVTNSHLT
ASPKLSTQQEAERQALQSLRQGGTLTGKFMS
T
SSIPGCLLGVALEGDGSPHGHASLLQHVLLLEQARQQSTLIA
VPLHGQSPLVTGERVATSMRTVGKLPR
H
RPLSRTQSSPLPQSPQALQQLVMQQQHQQFLEKQKQQQLQLGK
ILTKTGELPRQPTTHPEETEEELTEQ
Q
EVLLGEGALTMPREGSTESESTQEDLEEEDEEDDGEEEEDCIQVKDEEGESGAEEGPDLEEPGAGYKK
L
F
SDAQPLQPLQVYQAPLSLATVPHQALGRTQSSPAAPGGMKSPPDQPVKHLFTT
GVVYDTFMLKHQCMCG
N
THVHPEHAGRIQSIWSRLQETGLLSKCE
RIRGRKATLDEIQTVHSEYHTLLYGTSPLNRQKLDSKKLLG
P
ISQKMYAVLPCGGIG
VDSDTVWNEMHSSSAVRMAVGCLLELAFKVAAGELKNGFAIIRPPGHHAEESTA
M
GFCFFNSVAITAKLLQQKLNVGKVLIVDWDIHHGNGTQQAFYNDPSVLYISLHRYDNGNFFPGSGAPEE
V
GGGPGVGYNVNVAWTGGVDPPIGDVEYLTAF
RTVVMPIAHEFSPDVVLVSAGFDAVEGHLSPLGGYSVT
A
R
CFGHLTRQLMTLAGGRVVLALEGGHDLTAICDASEACVSALLSVELQPLDEAVLQQKPNINAVATLEK
V
IEIQ
SKHWSCVQKFAAGLGRSLREAQAGETEEAETVSAMALLSVGAEQAQAAAAREHSPRPAEEPMEQE
P
AL




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser