NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS32604.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
32604.1 Public Homo sapiens 17 BLMH 22 109 92 CCDS HistoryNCBI Gene:642Re-query CCDS DB by CCDS ID:32604.1Re-query CCDS DB by GeneID:642See the combined annotation on chromosome 17 in Sequence Viewer

Public since: CCDS release 3, NCBI annotation release 36.2, Ensembl annotation release 41

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 32604.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000261714.10 ENSP00000261714.6 Accepted alive Link to Ensembl Transcript Viewer:ENST00000261714.10Link to Ensembl Protein Viewer:ENSP00000261714.6Re-query CCDS DB by Nucleotide ID:ENST00000261714Re-query CCDS DB by Protein ID:ENSP00000261714
Original member Current member NCBI NM_000386.3 NP_000377.1 Accepted alive Link to Nucleotide Sequence:NM_000386.3Link to Protein Sequence:NP_000377.1Re-query CCDS DB by Nucleotide ID:NM_000386Re-query CCDS DB by Protein ID:NP_000377Link to BLAST:NP_000377.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_000377.1 455 Q13867 455 100% 0 0

Chromosomal Locations for CCDS 32604.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 17 (NC_000017.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17See the combined annotation on chromosome 17 in Sequence Viewer

Chromosome Start Stop Links
17 30249017 30249168 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 30266885 30266954 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 30271271 30271388 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 30272561 30272628 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 30272741 30272899 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 30274042 30274197 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 30285388 30285480 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 30286814 30286902 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 30287806 30287947 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 30289373 30289482 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 30291311 30291508 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 30291807 30291819 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1368 nt):
ATGAGCAGCTCGGGACTGAATTCGGAGAAGGTAGCTGCTCTGATACAGAAACTGAATTCCGACCCCCAGT
TC
GTACTTGCCCAGAATGTCGGGACCACCCACGACCTGCTGGACATCTGTCTGAAGCGGGCCACGGTGCA
G
CGCGCGCAGCATGTGTTCCAGCACGCCGTGCCCCAGGAGGGCAAGCCAATCACCAACCAGAAGAGCTCA
G
GG
CGATGCTGGATCTTTTCTTGTCTGAATGTTATGAGGCTTCCATTCATGAAAAAGTTAAATATTGAAG
AA
TTTGAGTTTAGCCAATCTTACCTGTTTTTTTGGGACAAGGTTGAACGCTGTTATTTCTTCTTGAGTGC
T
TTTGTGGACACAGCCCAGAGAAAGGAGCCTGAGGATGGGAGGCTGGTGCAGTTTTTGCTTATGAACCCT
GCA
AATGATGGTGGCCAATGGGATATGCTTGTTAATATTGTTGAAAAATATGGTGTTATCCCTAAGAAAT
GC
TTCCCTGAATCTTATACAACAGAGGCAACCAGAAGGATGAATGATATTCTGAATCACAAGATGAGAGA
A
TTCTGTATACGACTGCGGAACCTGGTACACAGTGGAGCAACCAAAGGAGAAATCTCGGCCACACAGGAC
GTC
ATGATGGAGGAGATATTCCGAGTGGTGTGCATCTGTTTGGGTAATCCACCAGAGACATTCACCTGGG
AA
TATCGAGACAAAGATAAAAATTATCAGAAAATTGGCCCCATAACACCCTTGGAGTTTTACAGGGAACA
T
GTCAAGCCACTCTTCAATATGGAAGATAAGATTTGTTTAGTGAATGACCCTAGGCCCCAGCACAAGTAC
AAC
AAACTTTACACAGTGGAATACTTAAGCAATATGGTTGGAGGGAGAAAAACTCTATACAACAACCAGC
CC
ATTGACTTCCTGAAAAAGATGGTTGCTGCCTCCATCAAAGATGGAGAGGCTGTGTGGTTTGGCTGTGA
T
GTTGGAAAACACTTCAATAGCAAGCTGGGCCTCAGTGACATGAATCTCTATGACCATGAGTTAGTGTTT
GGT
GTCTCCTTGAAGAACATGAATAAAGCGGAGAGGCTGACTTTTGGTGAGTCACTTATGACCCACGCCA
TG
ACCTTCACTGCTGTCTCAGAGAAGGATGATCAGGATGGTGCTTTCACAAAATGGAGAGTGGAGAATTC
A
TGGGGTGAAGACCATGGCCACAAAGGTTACCTGTGCATGACAGATGAGTGGTTCTCTGAGTATGTCTAC
GAA
GTGGTGGTGGACAGGAAGCATGTCCCTGAAGAGGTGCTAGCTGTGTTAGAGCAGGAACCCATTATCC
TG
CCAGCATGGGACCCCATGGGAGCTTTGGCTGAGTGA


Translation (455 aa):
MSSSGLNSEKVAALIQKLNSDPQFVLAQNVGTTHDLLDICLKRATVQRAQHVFQHAVPQEGKPITNQKSS
G
RCWIFSCLNVMRLPFMKKLNIEEFEFSQSYLFFWDKVERCYFFLSAFVDTAQRKEPEDGRLVQFLLMNP
A
NDGGQWDMLVNIV
EKYGVIPKKCFPESYTTEATRRMNDILNHKMREFCIRLRNLVHSGATKGEISATQD
V
MMEE
IFRVVCICLGNPPETFTWEYRDKDKNYQKIGPITPLEFYREHVKPLFNMEDKICLVNDPRPQHKY
N
KLYTVEYLSNMVGGRKTLYNNQPIDFLKKMVAASIKDGE
AVWFGCDVGKHFNSKLGLSDMNLYDHELVF
G
VSLKNMNKAERLTFGESLMTHAMTFTAVSEK
DDQDGAFTKWRVENSWGEDHGHKGYLCMTDEWFSEYVY
E
VVVDRKHVPEEVLAVLEQEPIILPAWDPMGALAE




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser