NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS32589.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
32589.1 Public Homo sapiens 17 ALDH3A2 22 109 92 CCDS HistoryNCBI Gene:224Re-query CCDS DB by CCDS ID:32589.1Re-query CCDS DB by GeneID:224See the combined annotation on chromosome 17 in Sequence Viewer

Public since: CCDS release 3, NCBI annotation release 36.2, Ensembl annotation release 41

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 32589.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000339618.8 ENSP00000345774.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000339618.8Link to Ensembl Protein Viewer:ENSP00000345774.4Re-query CCDS DB by Nucleotide ID:ENST00000339618Re-query CCDS DB by Protein ID:ENSP00000345774
Original member Current member EBI ENST00000581518.5 ENSP00000461916.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000581518.5Link to Ensembl Protein Viewer:ENSP00000461916.1Re-query CCDS DB by Nucleotide ID:ENST00000581518Re-query CCDS DB by Protein ID:ENSP00000461916
Original member NCBI NM_001031806.1 NP_001026976.1 Updated not alive Link to Nucleotide Sequence:NM_001031806.1Link to Protein Sequence:NP_001026976.1Re-query CCDS DB by Nucleotide ID:NM_001031806Re-query CCDS DB by Protein ID:NP_001026976
Current member NCBI NM_001031806.2 NP_001026976.1 Accepted alive Link to Nucleotide Sequence:NM_001031806.2Link to Protein Sequence:NP_001026976.1Re-query CCDS DB by Nucleotide ID:NM_001031806Re-query CCDS DB by Protein ID:NP_001026976Link to BLAST:NP_001026976.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001026976.1 508 P51648-2 508 100% 0 0

Chromosomal Locations for CCDS 32589.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 17 (NC_000017.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17See the combined annotation on chromosome 17 in Sequence Viewer

Chromosome Start Stop Links
17 19648972 19649124 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 19651547 19651778 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 19652547 19652632 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 19656366 19656574 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 19657745 19657862 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 19661127 19661268 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 19663333 19663499 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 19664948 19665047 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 19671721 19671956 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 19673151 19673234 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1527 nt):
ATGGAGCTCGAAGTCCGGCGGGTCCGACAGGCGTTCCTGTCCGGCCGGTCGCGACCTCTGCGGTTTCGGC
TG
CAGCAGCTGGAGGCCCTGCGGAGGATGGTGCAGGAGCGCGAGAAGGATATCCTGACGGCCATCGCCGC
C
GACCTGTGCAAGAGTGAATTCAATGTGTACAGTCAGGAAGTCATTACTGTCCTTGGGGAAATTGATTTT
ATG
CTTGAGAATCTTCCTGAATGGGTTACTGCTAAACCAGTTAAGAAGAACGTGCTCACCATGCTGGATG
AG
GCCTATATTCAGCCACAGCCTCTGGGAGTGGTGCTGATAATCGGAGCTTGGAATTACCCCTTCGTTCT
C
ACCATTCAGCCACTGATAGGAGCCATCGCTGCAGGAAATGCTGTGATTATAAAGCCTTCTGAACTGAGT
GAA
AATACAGCCAAGATCTTGGCAAAGCTTCTCCCTCAGTATTTAGACCAGGATCTCTATATTGTTATTA
AT
GGTGGTGTTGAGGAAACCACGGAGCTCCTGAAGCAGCGATTTGACCACATTTTCTATACGGGAAACAC
T
GCGGTTGGCAAAATTGTCATGGAAGCTGCTGCCAAGCATCTGACCCCTGTGACTCTTGAACTGGGAGGG
AAA
AGTCCATGTTATATTGATAAAGATTGTGACCTGGACATTGTTTGCAGACGCATAACCTGGGGAAAAT
AC
ATGAATTGTGGCCAAACCTGCATTGCACCCGACTATATTCTCTGTGAAGCATCCCTCCAAAATCAAAT
T
GTATGGAAGATTAAGGAAACAGTGAAGGAATTTTATGGAGAAAATATAAAAGAGTCTCCTGATTATGAA
AGG
ATCATCAATCTTCGTCATTTTAAGAGGATACTAAGTTTGCTTGAAGGACAAAAGATAGCTTTTGGTG
GG
GAGACTGATGAGGCCACACGCTACATAGCCCCAACAGTACTTACCGATGTTGATCCTAAAACCAAGGT
G
ATGCAAGAAGAAATTTTTGGACCAATTCTTCCAATAGTGCCTGTGAAAAATGTAGATGAGGCCATAAAT
TTC
ATAAATGAACGTGAAAAGCCTCTGGCTCTTTATGTATTTTCGCATAACCATAAGCTCATCAAACGGA
TG
ATTGATGAGACATCCAGTGGAGGTGTCACAGGCAATGACGTCATTATGCACTTCACGCTCAACTCTTT
C
CCATTTGGAGGAGTGGGTTCCAGTGGGATGGGAGCTTATCACGGAAAACATAGTTTTGATACTTTTTCT
CAT
CAGCGTCCCTGTTTATTAAAAAGTTTAAAGAGAGAAGGTGCTAACAAACTCAGATATCCTCCCAACA
GC
CAGTCAAAGGTGGATTGGGGAAAATTTTTTCTCTTGAAACGGTTCAACAAAGAAAAACTCGGTCTCCT
G
TTGCTCACTTTCCTGGGTATTGTAGCCGCTGTGCTTGTCAAGAAATACCAAGCTGTGCTGAGGAGAAAG
GCC
CTGTTGATTTTTCTGGTAGTTCACAGACTGCGTTGGTCCAGTAAGCAGAGATGA


Translation (508 aa):
MELEVRRVRQAFLSGRSRPLRFRLQQLEALRRMVQEREKDILTAIAADLCKSEFNVYSQEVITVLGEIDF
M
LENLPEWVTAKPVKKNVLTMLDEAYIQPQPLGVVLIIGAWNYPFVLTIQPLIGAIAA
GNAVIIKPSELS
E
NTAKILAKLLPQYLDQ
DLYIVINGGVEETTELLKQRFDHIFYTGNTAVGKIVMEAAAKHLTPVTLELGG
K
SPCYIDKDCDLDIVC
RRITWGKYMNCGQTCIAPDYILCEASLQNQIVWKIKETVKEFYGENIKESPDYE
R
IINLRHFKRILSLLEGQKIAFGGETDEATRYI
APTVLTDVDPKTKVMQEEIFGPILPIVPVKNVDEAIN
F
INEREKPLALYVFSHNHK
LIKRMIDETSSGGVTGNDVIMHFTLNSFPFGGVGSSGMGAYHGKHSFDTFS
H
QRPCLLKSLKREGANKLRYPPNSQSKVDWGKFFLLKRFNKEKLGLLLLTFLGIVAAVLVK
KYQAVLRRK
A
LLIFLVVHRLRWSSKQR




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser