NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS3242.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
3242.1 Public Homo sapiens 3 LAMP3 22 109 92 CCDS HistoryNCBI Gene:27074Re-query CCDS DB by CCDS ID:3242.1Re-query CCDS DB by GeneID:27074See the combined annotation on chromosome 3 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 3242.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000265598.7 ENSP00000265598.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000265598.7Link to Ensembl Protein Viewer:ENSP00000265598.3Re-query CCDS DB by Nucleotide ID:ENST00000265598Re-query CCDS DB by Protein ID:ENSP00000265598
Original member Current member NCBI NM_014398.3 NP_055213.2 Accepted alive Link to Nucleotide Sequence:NM_014398.3Link to Protein Sequence:NP_055213.2Re-query CCDS DB by Nucleotide ID:NM_014398Re-query CCDS DB by Protein ID:NP_055213Link to BLAST:NP_055213.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_055213.2 416 Q9UQV4 416 100% 0 0

Chromosomal Locations for CCDS 3242.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 3 (NC_000003.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3See the combined annotation on chromosome 3 in Sequence Viewer

Chromosome Start Stop Links
3 183124081 183124214 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 183135717 183135887 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 183140538 183140595 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 183152375 183152503 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 183153682 183154391 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 183162607 183162655 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1251 nt):
ATGCCCCGGCAGCTCAGCGCGGCGGCCGCGCTCTTCGCGTCCCTGGCCGTAATTTTGCACGATGGCAGTC
AA
ATGAGAGCAAAAGCATTTCCAGAAACCAGAGATTATTCTCAACCTACTGCAGCAGCAACAGTACAGGA
C
ATAAAAAAACCTGTCCAGCAACCAGCTAAGCAAGCACCTCACCAAACTTTAGCAGCAAGATTCATGGAT
GGT
CATATCACCTTTCAAACAGCGGCCACAGTAAAAATTCCAACAACTACCCCAGCGACTACAAAAAACA
CT
GCAACCACCAGCCCAATTACCTACACCCTGGTCACAACCCAGGCCACACCCAACAACTCACACACAGC
T
CCTCCAGTTACTGAAGTTACAGTCGGCCCTAGCTTAGCCCCTTATTCACTGCCACCCACCATCACCCCA
CCA
GCTCATACAACTGGAACCAGTTCATCAACCGTCAGCCACACAACTGGGAACACCACTCAACCCAGTA
AC
CAGACCACCCTTCCAGCAACTTTATCGATAGCACTGCACAAAAGCACAACCGGTCAGAAGCCTGTTCA
A
CCCACCCATGCCCCAGGAACAACGGCAGCTGCCCACAATACCACCCGCACAGCTGCACCTGCCTCCACG
GTT
CCTGGGCCCACCCTTGCACCTCAGCCATCGTCAGTCAAGACTGGAATTTATCAGGTTCTAAACGGAA
GC
AGACTCTGTATAAAAGCAGAGATGGGGATACAGCTGATTGTTCAAGACAAGGAGTCGGTTTTTTCACC
T
CGGAGATACTTCAACATCGACCCCAACGCAACGCAAGCCTCTGGGAACTGTGGCACCCGAAAATCCAAC
CTT
CTGTTGAATTTTCAGGGCGGATTTGTGAATCTCACATTTACCAAGGATGAAGAATCATATTATATCA
GT
GAAGTGGGAGCCTATTTGACCGTCTCAGATCCAGAGACAATTTACCAAGGAATCAAACATGCGGTGGT
G
ATGTTCCAGACAGCAGTCGGGCATTCCTTCAAGTGCGTGAGTGAACAGAGCCTCCAGTTGTCAGCCCAC
CTG
CAGGTGAAAACAACCGATGTCCAACTTCAAGCCTTTGATTTTGAAGATGACCACTTTGGAAATGTGG
AT
GAGTGCTCGTCTGACTACACAATTGTGCTTCCTGTGATTGGGGCCATCGTGGTTGGTCTCTGCCTTAT
G
GGTATGGGTGTCTATAAAATCCGCCTAAGGTGTCAATCATCTGGATACCAGAGAATCTAA


Translation (416 aa):
MPRQLSAAAALFASLAVILHDGSQMRAKAFPETRDYSQPTAAATVQDIKKPVQQPAKQAPHQTLAARFMD
G
HITFQTAATVKIPTTTPATTKNTATTSPITYTLVTTQATPNNSHTAPPVTEVTVGPSLAPYSLPPTITP
P
AHTTGTSSSTVSHTTGNTTQPSNQTTLPATLSIALHKSTTGQKPVQPTHAPGTTAAAHNTTRTAAPAST
V
PGPTLAPQPSSVKTGIYQVLNGSRLCIKAEMGIQLIVQDKES
VFSPRRYFNIDPNATQASGNCGTRKSN
L
LLNFQGGFVNLTFTK
DEESYYISEVGAYLTVSDPETIYQGIKHAVVMFQTAVGHSFKCVSEQSLQLSAH
L
QVKTTDVQLQAFDFEDDHFGN
VDECSSDYTIVLPVIGAIVVGLCLMGMGVYKIRLRCQSSGYQRI



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser