NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS32231.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
32231.1 Public Homo sapiens 15 DUT 22 109 92 CCDS HistoryNCBI Gene:1854Re-query CCDS DB by CCDS ID:32231.1Re-query CCDS DB by GeneID:1854See the combined annotation on chromosome 15 in Sequence Viewer

Public since: CCDS release 3, NCBI annotation release 36.2, Ensembl annotation release 41

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 32231.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000331200.7 ENSP00000370376.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000331200.7Link to Ensembl Protein Viewer:ENSP00000370376.2Re-query CCDS DB by Nucleotide ID:ENST00000331200Re-query CCDS DB by Protein ID:ENSP00000370376
Original member NCBI NM_001025248.1 NP_001020419.1 Updated not alive Link to Nucleotide Sequence:NM_001025248.1Link to Protein Sequence:NP_001020419.1Re-query CCDS DB by Nucleotide ID:NM_001025248Re-query CCDS DB by Protein ID:NP_001020419
Current member NCBI NM_001025248.2 NP_001020419.1 Accepted alive Link to Nucleotide Sequence:NM_001025248.2Link to Protein Sequence:NP_001020419.1Re-query CCDS DB by Nucleotide ID:NM_001025248Re-query CCDS DB by Protein ID:NP_001020419Link to BLAST:NP_001020419.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001020419.1 252 P33316-3 252 100% 0 0

Chromosomal Locations for CCDS 32231.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 15 (NC_000015.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15See the combined annotation on chromosome 15 in Sequence Viewer

Chromosome Start Stop Links
15 48331516 48331795 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 48332268 48332406 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 48334417 48334508 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 48336046 48336090 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 48341289 48341363 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 48341515 48341585 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 48342022 48342078 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (759 nt):
ATGACTCCCCTCTGCCCTCGCCCCGCGCTCTGCTACCATTTCCTTACGTCTCTGCTTCGCTCAGCGATGC
AA
AACGCGCGAGGCGCACGGCAGAGGGCCGAAGCCGCGGTACTCTCCGGGCCAGGCCCGCCCCTCGGCCG
C
GCCGCGCAGCACGGGATTCCCCGGCCGCTGTCCAGCGCTGGCCGCCTGAGCCAAGGCTGCCGCGGAGCC
AGT
ACAGTCGGGGCCGCTGGCTGGAAGGGCGAGCTTCCTAAGGCGGGGGGAAGCCCGGCGCCGGGGCCGG
AG
ACACCCGCCATTTCACCCAGTAAGCGGGCCCGGCCTGCGGAGGTGGGCGGCATGCAGCTCCGCTTTGC
C
CGGCTCTCCGAGCACGCCACGGCCCCCACCCGGGGCTCCGCGCGCGCCGCGGGCTACGACCTGTACAGT
GCC
TATGATTACACAATACCACCTATGGAGAAAGCTGTTGTGAAAACGGACATTCAGATAGCGCTCCCTT
CT
GGGTGTTATGGAAGAGTGGCTCCACGGTCAGGCTTGGCTGCAAAACACTTTATTGATGTAGGAGCTGG
T
GTCATAGATGAAGATTATAGAGGAAATGTTGGTGTTGTACTGTTTAATTTTGGCAAAGAAAAGTTTGAA
G
TC
AAAAAAGGTGATCGAATTGCACAGCTCATTTGCGAACGGATTTTTTATCCAGAAATAGAAGAAGTTC
AA
GCCTTGGATGACACCGAAAGGGGTTCAGGAGGTTTTGGTTCCACTGGAAAGAATTAA


Translation (252 aa):
MTPLCPRPALCYHFLTSLLRSAMQNARGARQRAEAAVLSGPGPPLGRAAQHGIPRPLSSAGRLSQGCRGA
S
TVGAAGWKGELPKAGGSPAPGP
ETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYS
A
YDYTIPPMEKAVVKTDIQIALPSGCYGRV
APRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFE
V
KKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser