NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS32217.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
32217.1 Public Homo sapiens 15 CKMT1A 24 110 108 CCDS HistoryNCBI Gene:548596Re-query CCDS DB by CCDS ID:32217.1Re-query CCDS DB by GeneID:548596See the combined annotation on chromosome 15 in Sequence Viewer

Public since: CCDS release 3, NCBI annotation release 36.2, Ensembl annotation release 41

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 32217.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000413453.7 ENSP00000406577.3 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000413453.7Link to Ensembl Protein Viewer:ENSP00000406577.3Re-query CCDS DB by Nucleotide ID:ENST00000413453Re-query CCDS DB by Protein ID:ENSP00000406577
Original member Current member EBI ENST00000434505.5 ENSP00000413165.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000434505.5Link to Ensembl Protein Viewer:ENSP00000413165.1Re-query CCDS DB by Nucleotide ID:ENST00000434505Re-query CCDS DB by Protein ID:ENSP00000413165
Original member Current member NCBI NM_001015001.2 NP_001015001.1 Accepted alive Link to Nucleotide Sequence:NM_001015001.2Link to Protein Sequence:NP_001015001.1Re-query CCDS DB by Nucleotide ID:NM_001015001Re-query CCDS DB by Protein ID:NP_001015001Link to BLAST:NP_001015001.1
Original member Current member NCBI NM_001321926.2 NP_001308855.1 MANE Select Accepted alive Link to Nucleotide Sequence:NM_001321926.2Link to Protein Sequence:NP_001308855.1Re-query CCDS DB by Nucleotide ID:NM_001321926Re-query CCDS DB by Protein ID:NP_001308855Link to BLAST:NP_001308855.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001015001.1 417 P12532-1 417 100% 0 0
NP_001308855.1 417 P12532-1 417 100% 0 0

Chromosomal Locations for CCDS 32217.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '+' strand of Chromosome 15 (NC_000015.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15See the combined annotation on chromosome 15 in Sequence Viewer

Chromosome Start Stop Links
15 43694051 43694199 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 43694804 43695002 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 43695206 43695301 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 43695688 43695909 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 43696039 43696124 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 43696240 43696363 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 43698014 43698148 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 43698641 43698766 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 43698973 43699089 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1254 nt):
ATGGCTGGTCCCTTCTCCCGTCTGCTGTCCGCCCGCCCGGGACTCAGGCTCCTGGCTTTGGCCGGAGCGG
GG
TCTCTAGCCGCTGGGTTTCTGCTCCGACCGGAACCTGTACGAGCTGCCAGTGAACGACGGAGGCTGTA
T
CCCCCGAGCGCTGAGTACCCAGACCTCCGAAAGCACAACAACTGCATGGCCAGTCACCTGACCCCAGCA
GTC
TATGCACGGCTCTGCGACAAGACCACACCCACTGGTTGGACGCTAGATCAGTGTATCCAGACTGGCG
TG
GACAACCCTGGCCACCCCTTCATCAAGACTGTGGGCATGGTGGCTGGAGATGAGGAGACCTATGAGGT
A
TTTGCTGACCTGTTTGACCCTGTGATCCAAGAGCGACACAATGGATATGACCCCCGGACAATGAAGCAC
ACC
ACGGATCTAGATGCCAGTAAAATCCGTTCTGGCTACTTTGATGAGAGGTATGTATTGTCCTCTAGAG
TC
AGAACTGGCCGAAGCATCCGAGGACTCAGTCTGCCTCCAGCTTGCACTCGAGCAGAGCGACGAGAGGT
G
GAACGTGTTGTGGTGGATGCACTGAGTGGCCTGAAGGGTGACCTGGCTGGACGTTACTATAGGCTCAGT
GAG
ATGACAGAGGCTGAACAGCAGCAGCTTATTGATGACCACTTTCTGTTTGATAAGCCTGTGTCCCCGT
TG
CTGACTGCAGCAGGAATGGCTCGAGACTGGCCAGATGCTCGTGGAATTTGGCACAACAATGAGAAGAG
C
TTCCTGATCTGGGTGAATGAGGAGGATCATACACGGGTGATCTCCATGGAGAAGGGTGGTAACATGAAG
AGA
GTGTTTGAAAGATTCTGCCGAGGCCTCAAAGAGGTGGAGAGACTTATCCAAGAACGTGGCTGGGAGT
TC
ATGTGGAATGAGCGTTTGGGATACATCTTGACCTGTCCATCTAACCTGGGCACTGGACTTCGGGCAGG
A
GTGCACATCAAACTGCCCCTGCTAAGCAAAGATAGCCGCTTCCCAAAGATCCTGGAGAACCTAAGACTC
CAA
AAGCGTGGTACTGGAGGAGTGGACACTGCTGCCACAGGCGGTGTCTTTGATATTTCTAATTTGGACC
GA
CTAGGCAAATCAGAGGTGGAGCTGGTGCAACTGGTCATCGATGGAGTAAACTATTTGATTGATTGTGA
A
CGGCGTCTGGAGAGAGGCCAGGATATCCGCATCCCCACACCTGTCATCCACACCAAGCATTAA


Translation (417 aa):
MAGPFSRLLSARPGLRLLALAGAGSLAAGFLLRPEPVRAASERRRLYPPSAEYPDLRKHNNCMASHLTPA
V
YARLCDKTTPTGWTLDQCIQTGVDNPGHPFIKTVGMVAGDEETYE
VFADLFDPVIQERHNGYDPRTMKH
T
TDLDASK
IRSGYFDERYVLSSRVRTGRSIRGLSLPPACTRAERREVERVVVDALSGLKGDLAGRYYRLS
E
MTEAEQQQLID
DHFLFDKPVSPLLTAAGMARDWPDARGIWHNNEKSFLIWVNEEDHTRVISMEKGGNMK
R
VFERFCRGLKE
VERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHIKLPLLSKDSRFPKILENLRL
Q
KRGTGGVDTAATGGVFDISNLDRLGKSE
VELVQLVIDGVNYLIDCERRLERGQDIRIPTPVIHTKH



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser