NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS32139.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
32139.1 Public Homo sapiens 14 PSMC1 22 109 92 CCDS HistoryNCBI Gene:5700Re-query CCDS DB by CCDS ID:32139.1Re-query CCDS DB by GeneID:5700See the combined annotation on chromosome 14 in Sequence Viewer

Public since: CCDS release 3, NCBI annotation release 36.2, Ensembl annotation release 41

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 32139.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000261303.12 ENSP00000261303.8 Accepted alive Link to Ensembl Transcript Viewer:ENST00000261303.12Link to Ensembl Protein Viewer:ENSP00000261303.8Re-query CCDS DB by Nucleotide ID:ENST00000261303Re-query CCDS DB by Protein ID:ENSP00000261303
Original member NCBI NM_002802.2 NP_002793.2 Updated not alive Link to Nucleotide Sequence:NM_002802.2Link to Protein Sequence:NP_002793.2Re-query CCDS DB by Nucleotide ID:NM_002802Re-query CCDS DB by Protein ID:NP_002793
Current member NCBI NM_002802.3 NP_002793.2 Accepted alive Link to Nucleotide Sequence:NM_002802.3Link to Protein Sequence:NP_002793.2Re-query CCDS DB by Nucleotide ID:NM_002802Re-query CCDS DB by Protein ID:NP_002793Link to BLAST:NP_002793.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_002793.2 440 P62191-1 440 100% 0 0

Chromosomal Locations for CCDS 32139.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 14 (NC_000014.9)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14See the combined annotation on chromosome 14 in Sequence Viewer

Chromosome Start Stop Links
14 90256598 90256600 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 90259160 90259213 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 90260115 90260211 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 90263318 90263442 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 90263662 90263847 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 90264041 90264169 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 90265070 90265166 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 90268224 90268413 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 90269397 90269548 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 90270198 90270352 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 90272273 90272407 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1323 nt):
ATGGGTCAAAGTCAGAGTGGTGGTCATGGTCCTGGAGGTGGCAAGAAGGATGACAAGGACAAGAAAAAGA
AA
TATGAACCTCCTGTACCAACTAGAGTGGGGAAAAAGAAGAAGAAAACAAAGGGACCAGATGCTGCCAG
C
AAACTGCCACTGGTGACACCTCACACTCAGTGCCGGTTAAAATTACTGAAGTTAGAGAGAATTAAAGAC
TAT
CTTCTCATGGAGGAAGAATTCATTAGAAATCAGGAACAAATGAAACCATTAGAAGAAAAGCAAGAGG
AG
GAAAGATCAAAAGTGGATGATCTGAGGGGGACCCCGATGTCAGTAGGAACCTTGGAAGAGATCATTGA
T
GACAATCATGCCATCGTGTCTACATCTGTGGGCTCAGAACACTACGTCAGCATTCTTTCATTTGTAGAC
AAG
GATCTGCTGGAACCTGGCTGCTCGGTCCTGCTCAACCACAAGGTGCATGCCGTGATAGGGGTGCTGA
TG
GATGACACGGATCCCCTGGTCACAGTGATGAAGGTAGAAAAGGCCCCCCAGGAGACCTATGCAGATAT
T
GGGGGGTTGGACAACCAAATTCAGGAAATTAAGGAATCTGTGGAGCTTCCTCTCACCCATCCTGAATAT
TAT
GAAGAGATGGGTATAAAGCCTCCTAAGGGGGTCATTCTCTATGGTCCACCTGGCACAGGTAAAACCT
TG
TTAGCCAAAGCAGTAGCAAACCAAACCTCAGCCACTTTCTTGAGAGTGGTTGGCTCTGAACTTATTCA
G
AAGTACCTAGGTGATGGGCCCAAACTCGTACGGGAATTGTTCCGAGTTGCTGAAGAACATGCACCGTCC
ATC
GTGTTTATTGATGAAATTGACGCCATTGGGACAAAAAGATATGACTCCAATTCTGGTGGTGAGAGAG
AA
ATTCAGCGAACAATGTTGGAACTGCTGAACCAGTTGGATGGATTTGATTCTAGGGGAGATGTGAAAGT
T
ATCATGGCCACAAACCGAATAGAAACTTTGGATCCAGCACTTATCAGACCAGGCCGCATTGACAGGAAG
ATT
GAGTTCCCCCTGCCTGATGAAAAGACGAAGAAGCGCATCTTTCAGATTCACACAAGCAGGATGACGC
TG
GCTGATGATGTAACCCTGGACGACCTGATCATGGCTAAAGATGACCTCTCTGGTGCTGACATCAAGGC
A
ATCTGTACAGAAGCTGGTCTGATGGCCTTAAGAGAACGTAGAATGAAAGTAACAAATGAAGACTTCAAA
AAA
TCTAAAGAAAATGTTCTTTATAAGAAACAGGAAGGCACCCCTGAGGGGCTGTATCTCTAA


Translation (440 aa):
MGQSQSGGHGPGGGKKDDKDKKKKYEPPVPTRVGKKKKKTKGPDAASKLPLVTPHTQCRLKLLKLERIKD
Y
LLMEEEFIRNQEQMKPLEEKQE
EERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVD
K
DLLEPGCSVLLNHK
VHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQEIKESVELPLTHPEY
Y
EEMGIKPPKGVILYGPPGT
GKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPS
I
VFIDEIDAIGTK
RYDSNSGGEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRK
I
EFPLPDEKTKKRIFQIHTSRMTLADDVTLDDLIMAKDDLSGADIK
AICTEAGLMALRERRMKVTNEDFK
K
SKENVLYKKQEGTPEGLYL




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser