NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS32116.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
32116.1 Public Homo sapiens 14 NUMB 22 109 92 CCDS HistoryNCBI Gene:8650Re-query CCDS DB by CCDS ID:32116.1Re-query CCDS DB by GeneID:8650See the combined annotation on chromosome 14 in Sequence Viewer

Public since: CCDS release 3, NCBI annotation release 36.2, Ensembl annotation release 41

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 32116.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000355058.7 ENSP00000347169.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000355058.7Link to Ensembl Protein Viewer:ENSP00000347169.3Re-query CCDS DB by Nucleotide ID:ENST00000355058Re-query CCDS DB by Protein ID:ENSP00000347169
Original member Current member EBI,WTSI ENST00000555238.5 ENSP00000451300.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000555238.5Link to Ensembl Protein Viewer:ENSP00000451300.1Re-query CCDS DB by Nucleotide ID:ENST00000555238Re-query CCDS DB by Protein ID:ENSP00000451300
Original member Current member NCBI NM_001005743.1 NP_001005743.1 Accepted alive Link to Nucleotide Sequence:NM_001005743.1Link to Protein Sequence:NP_001005743.1Re-query CCDS DB by Nucleotide ID:NM_001005743Re-query CCDS DB by Protein ID:NP_001005743Link to BLAST:NP_001005743.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001005743.1 651 P49757-1 651 100% 0 0

Chromosomal Locations for CCDS 32116.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 14 (NC_000014.9)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14See the combined annotation on chromosome 14 in Sequence Viewer

Chromosome Start Stop Links
14 73276578 73277293 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 73279281 73279424 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 73282359 73282505 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 73284081 73284374 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 73287110 73287314 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 73292734 73292874 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 73297211 73297285 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 73316390 73316422 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 73323130 73323204 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 73355626 73355751 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1956 nt):
ATGAACAAATTACGGCAAAGTTTTAGGAGAAAGAAGGATGTTTATGTTCCAGAGGCCAGTCGTCCACATC
AG
TGGCAGACAGATGAAGAAGGCGTTCGCACCGGAAAATGTAGCTTCCCGGTTAAGTACCTTGGCCATGT
A
GAAGTTGATGAATCAAGAGGAATGCACATCTGTGAAGATGCTGTAAAAAGATTGAAAGCTGAAAGGAAG
TTC
TTCAAAGGCTTCTTTGGAAAAACTGGAAAGAAAGCAGTTAAAGCAGTTCTGTGGGTCTCAGCAGATG
GA
CTCAGAGTTGTGGATGAAAAAACTAAGGACCTCATAGTTGACCAGACGATAGAGAAAGTTTCTTTCTG
T
GCCCCAGACAGGAACTTTGATAGAGCCTTTTCTTACATATGCCGTGATGGCACCACTCGTCGCTGGATC
TGT
CACTGCTTCATGGCTGTCAAGGACACAGGTGAAAGGTTGAGCCATGCAGTAGGCTGTGCTTTTGCAG
CC
TGTTTAGAGCGCAAGCAGAAGCGGGAGAAGGAATGTGGAGTGACTGCTACTTTTGATGCTAGTCGGAC
C
ACTTTTACAAGAGAAGGATCATTCCGTGTCACAACAGCCACTGAACAAGCAGAAAGAGAGGAGATCATG
AAA
CAAATGCAAGATGCCAAGAAAGCTGAAACAGATAAGATAGTCGTTGGTTCATCAGTTGCCCCTGGCA
AC
ACTGCCCCATCCCCATCCTCTCCCACCTCTCCTACTTCTGATGCCACGACCTCTCTGGAGATGAACAA
T
CCTCATGCCATCCCACGCCGGCATGCTCCAATTGAACAGCTTGCTCGCCAAGGCTCTTTCCGAGGTTTT
CCT
GCTCTTAGCCAGAAGATGTCACCCTTTAAACGCCAACTATCCCTACGCATCAATGAGTTGCCTTCCA
CT
ATGCAGAGGAAGACTGATTTCCCCATTAAAAATGCAGTGCCAGAAGTAGAAGGGGAGGCAGAGAGCAT
C
AGCTCCCTGTGCTCACAGATCACCAATGCCTTCAGCACACCTGAGGACCCCTTCTCATCTGCTCCGATG
ACC
AAACCAGTGACAGTGGTGGCACCACAATCTCCTACCTTCCAAGCTAATGGCACTGACTCAGCCTTCC
AT
GTGCTTGCTAAGCCAGCCCATACTGCTCTAGCACCCGTAGCAATGCCTGTGCGTGAAACCAACCCTTG
G
GCCCATGCCCCTGATGCTGCTAACAAGGAAATTGCAGCCACATGTTCGGGGACCGAGTGGGGTCAATCT
TCT
GGTGCTGCCTCTCCAGGTCTCTTCCAGGCCGGTCATAGACGTACTCCCTCTGAGGCCGACCGATGGT
TA
GAAGAGGTGTCTAAGAGCGTCCGGGCTCAGCAGCCCCAGGCCTCAGCTGCTCCTCTGCAGCCAGTTCT
C
CAGCCTCCTCCACCCACTGCCATCTCCCAGCCAGCATCACCTTTCCAAGGGAATGCATTCCTCACCTCT
CAG
CCTGTGCCAGTGGGTGTGGTCCCAGCCCTGCAACCAGCCTTTGTCCCTGCCCAGTCCTATCCTGTGG
CC
AATGGAATGCCCTATCCAGCCCCTAATGTGCCTGTGGTGGGCATCACTCCCTCCCAGATGGTGGCCAA
C
GTATTTGGCACTGCAGGCCACCCTCAGGCTGCCCATCCCCATCAGTCACCCAGCCTGGTCAGGCAGCAG
ACA
TTCCCTCACTACGAGGCAAGCAGTGCTACCACCAGTCCCTTCTTTAAGCCTCCTGCTCAGCACCTCA
AC
GGTTCTGCAGCTTTCAATGGTGTAGATGATGGCAGGTTGGCCTCAGCAGACAGGCATACAGAGGTTCC
T
ACAGGCACCTGCCCAGTGGATCCTTTTGAAGCCCAGTGGGCTGCATTAGAAAATAAGTCCAAGCAGCGT
ACT
AATCCCTCCCCTACCAACCCTTTCTCCAGTGACTTACAGAAGACGTTTGAAATTGAACTTTAA


Translation (651 aa):
MNKLRQSFRRKKDVYVPEASRPHQWQTDEEGVRTGKCSFPVKYLGHVEVDESRGMHICEDAVKRLKAERK
F
FKGFFGK
TGKKAVKAVLWVSADGLRVVDEKTKDLIVDQTIEKVSFCAPDRNFDRAFSYICRDGTTRRWI
C
HCFMAVKDT
GERLSHAVGCAFAACLERKQKREKECGVTATFDASRTTFTREGSFRVTTATEQAEREEIM
K
QMQDAKK
AETDKIVVGSSVAPGNTAPSPSSPTSPTSDATTSLEMNNPHAIPRRHAPIEQLARQGSFRGF
P
ALSQKMSPFKRQLSLRINELPSTMQRKTDFPIKNA
VPEVEGEAESISSLCSQITNAFSTPEDPFSSAPM
T
KPVTVVAPQSPTFQ
ANGTDSAFHVLAKPAHTALAPVAMPVRETNPWAHAPDAANKEIAATCSGTEWGQS
S
GAASPGLFQAGHRRTPSEADRWLEEVSKSVRAQQPQASAAPLQPVLQPPPPTAISQPASPFQGNAFLTS
Q
PVPVGVVPALQPAFVPAQSYPVANGMPYPAPNVPVVGITPSQMVANVFGTAGHPQAAHPHQSPSLVRQQ
T
FPHYEASSATTSPFFKPPAQHLNGSAAFNGVDDGRLASADRHTEVPTGTCPVDPFEAQWAALENKSKQR
T
NPSPTNPFSSDLQKTFEIEL




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser