NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS31797.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
31797.1 Public Homo sapiens 12 TMBIM6 24 110 108 CCDS HistoryNCBI Gene:7009Re-query CCDS DB by CCDS ID:31797.1Re-query CCDS DB by GeneID:7009See the combined annotation on chromosome 12 in Sequence Viewer

Public since: CCDS release 3, NCBI annotation release 36.2, Ensembl annotation release 41

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 31797.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000267115.10 ENSP00000267115.5 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000267115.10Link to Ensembl Protein Viewer:ENSP00000267115.5Re-query CCDS DB by Nucleotide ID:ENST00000267115Re-query CCDS DB by Protein ID:ENSP00000267115
Original member Current member EBI ENST00000395006.8 ENSP00000378454.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000395006.8Link to Ensembl Protein Viewer:ENSP00000378454.4Re-query CCDS DB by Nucleotide ID:ENST00000395006Re-query CCDS DB by Protein ID:ENSP00000378454
Original member Current member EBI ENST00000549385.5 ENSP00000448036.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000549385.5Link to Ensembl Protein Viewer:ENSP00000448036.1Re-query CCDS DB by Nucleotide ID:ENST00000549385Re-query CCDS DB by Protein ID:ENSP00000448036
Original member Current member EBI ENST00000552370.5 ENSP00000450158.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000552370.5Link to Ensembl Protein Viewer:ENSP00000450158.2Re-query CCDS DB by Nucleotide ID:ENST00000552370Re-query CCDS DB by Protein ID:ENSP00000450158
Original member Current member NCBI NM_003217.3 NP_003208.2 MANE Select Accepted alive Link to Nucleotide Sequence:NM_003217.3Link to Protein Sequence:NP_003208.2Re-query CCDS DB by Nucleotide ID:NM_003217Re-query CCDS DB by Protein ID:NP_003208Link to BLAST:NP_003208.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_003208.2 237 P55061-1 237 100% 0 0

Chromosomal Locations for CCDS 31797.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '+' strand of Chromosome 12 (NC_000012.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12See the combined annotation on chromosome 12 in Sequence Viewer

Chromosome Start Stop Links
12 49752494 49752549 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 49752973 49753081 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 49755635 49755755 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 49758227 49758275 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 49758383 49758480 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 49758683 49758762 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 49759221 49759321 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 49761704 49761779 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 49762873 49762896 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (714 nt):
ATGAACATATTTGATCGAAAGATCAACTTTGATGCGCTTTTAAAATTTTCTCATATAACCCCGTCAACGC
AG
CAGCACCTGAAGAAGGTCTATGCAAGTTTTGCCCTTTGTATGTTTGTGGCGGCTGCAGGGGCCTATGT
C
CATATGGTCACTCATTTCATTCAGGCTGGCCTGCTGTCTGCCTTGGGCTCCCTGATATTGATGATTTGG
CTG
ATGGCAACACCTCATAGCCATGAAACTGAACAGAAAAGACTGGGACTTCTTGCTGGATTTGCATTCC
TT
ACAGGAGTTGGCCTGGGCCCTGCCCTGGAGTTTTGTATTGCTGTCAACCCCAGCATCCTTCCCACTGC
T
TTCATGGGCACGGCAATGATCTTTACCTGCTTCACCCTCAGTGCACTCTATGCCAGGCGCCGTAGCTAC
CTC
TTTCTGGGAGGTATCTTGATGTCAGCCCTGAGCTTGTTGCTTTTGTCTTCCCTGGGGAATGTTTTCT
TT
GGATCCATTTGGCTTTTCCAGGCAAACCTGTATGTGGGACTGGTGGTCATGTGTGGCTTCGTCCTTTT
T
GATACTCAACTCATTATTGAAAAGGCCGAACATGGAGATCAAGATTATATCTGGCACTGCATTGATCTC
TTC
TTAGATTTCATTACTGTCTTCAGAAAACTCATGATGATCCTGGCCATGAATGAAAAGGATAAGAAGA
AA
GAGAAGAAATGA


Translation (237 aa):
MNIFDRKINFDALLKFSHITPSTQQHLKKVYASFALCMFVAAAGAYVHMVTHFIQAGLLSALGSLILMIW
L
MATPHSHETEQKRLGLLAGFAFLT
GVGLGPALEFCIAVNPSILPTAFMGTAMIFTCFTLSALYARRRSY
L
FLG
GILMSALSLLLLSSLGNVFFGSIWLFQANLYVGLVVMCGFVLFDTQLIIEKAEHGDQDYIWHCIDL
F
LDFITVFRKLMMILAMNEK
DKKKEKK



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser