NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS31761.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
31761.1 Public Homo sapiens 12 STK38L 22 109 92 CCDS HistoryNCBI Gene:23012Re-query CCDS DB by CCDS ID:31761.1Re-query CCDS DB by GeneID:23012See the combined annotation on chromosome 12 in Sequence Viewer

Public since: CCDS release 3, NCBI annotation release 36.2, Ensembl annotation release 41

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 31761.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000389032.7 ENSP00000373684.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000389032.7Link to Ensembl Protein Viewer:ENSP00000373684.3Re-query CCDS DB by Nucleotide ID:ENST00000389032Re-query CCDS DB by Protein ID:ENSP00000373684
Original member NCBI NM_015000.3 NP_055815.1 Updated not alive Link to Nucleotide Sequence:NM_015000.3Link to Protein Sequence:NP_055815.1Re-query CCDS DB by Nucleotide ID:NM_015000Re-query CCDS DB by Protein ID:NP_055815
Current member NCBI NM_015000.4 NP_055815.1 Accepted alive Link to Nucleotide Sequence:NM_015000.4Link to Protein Sequence:NP_055815.1Re-query CCDS DB by Nucleotide ID:NM_015000Re-query CCDS DB by Protein ID:NP_055815Link to BLAST:NP_055815.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_055815.1 464 Q9Y2H1-1 464 100% 0 0

Chromosomal Locations for CCDS 31761.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 12 (NC_000012.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12See the combined annotation on chromosome 12 in Sequence Viewer

Chromosome Start Stop Links
12 27297721 27297854 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 27302137 27302188 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 27308339 27308461 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 27309114 27309197 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 27312549 27312672 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 27314504 27314658 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 27315015 27315117 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 27315289 27315350 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 27317336 27317453 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 27317896 27318019 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 27319328 27319423 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 27322143 27322234 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 27322328 27322455 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1395 nt):
ATGGCAATGACGGCAGGGACTACAACAACCTTTCCTATGAGCAACCATACCCGGGAAAGAGTGACTGTAG
CC
AAGCTCACATTGGAGAATTTTTATAGCAACCTAATTTTACAGCATGAAGAGAGAGAAACCAGGCAGAA
G
AAATTAGAAGTGGCCATGGAAGAAGAAGGATTAGCAGATGAAGAGAAAAAGTTACGTCGATCACAACAC
GCT
CGCAAAGAAACAGAGTTCTTACGGCTCAAAAGGACCAGACTTGGCTTGGATGACTTTGAGTCTCTGA
AA
GTTATAGGAAGAGGAGCTTTTGGAGAGGTGCGGTTGGTCCAGAAGAAAGATACAGGCCATATCTATGC
A
ATGAAGATATTGAGAAAGTCTGATATGCTTGAAAAAGAGCAGGTGGCCCATATCCGAGCAGAAAGAGAT
ATT
TTGGTAGAAGCAGATGGTGCCTGGGTGGTGAAGATGTTTTACAGTTTTCAGGATAAGAGGAATCTTT
AT
CTAATCATGGAATTTCTCCCTGGAGGTGACATGATGACATTGCTAATGAAGAAAGACACCTTGACAGA
A
GAGGAAACACAGTTCTACATTTCAGAGACTGTTCTGGCAATAGATGCGATCCACCAGTTGGGTTTCATC
CAT
CGGGATATTAAGCCAGACAACCTTTTATTGGATGCCAAGGGTCATGTAAAATTATCTGATTTTGGTT
TA
TGTACGGGATTAAAGAAAGCTCACAGGACTGAATTTTATAGAAATCTCACACACAACCCACCAAGTGA
C
TTCTCATTTCAGAACATGAACTCAAAGAGGAAAGCAGAAACTTGGAAGAAGAACAGGAGACAACTGGCA
TAT
TCCACAGTTGGGACACCAGATTACATTGCTCCAGAAGTATTCATGCAGACTGGTTACAACAAATTGT
GT
GACTGGTGGTCTTTGGGAGTGATTATGTATGAAATGCTAATAGGATATCCACCTTTCTGCTCTGAAAC
A
CCTCAAGAAACGTACAGAAAAGTGATGAACTGGAAAGAAACTCTGGTATTTCCTCCAGAGGTACCTATA
TCT
GAGAAAGCCAAGGACTTAATTCTCAGATTTTGTATTGATTCTGAAAACAGAATTGGAAATAGTGGAG
TA
GAAGAAATAAAAGGTCATCCCTTTTTTGAAGGTGTCGACTGGGAGCACATAAGGGAAAGGCCAGCAGC
A
ATCCCTATAGAAATCAAAAGCATTGATGATACTTCAAATTTTGATGACTTCCCTGAATCTGATATTTTA
CAA
CCAGTGCCAAATACCACAGAACCGGACTACAAATCCAAAGACTGGGTTTTTCTCAATTATACCTATA
AA
AGGTTTGAAGGGTTGACTCAACGTGGCTCTATCCCCACCTACATGAAAGCTGGGAAGTTATGA


Translation (464 aa):
MAMTAGTTTTFPMSNHTRERVTVAKLTLENFYSNLILQHEERETRQKKLEVAMEEEGLADEEKKLRRSQH
A
RKETEFLRLKRTRLGLDDFESLKVIGRGAFGE
VRLVQKKDTGHIYAMKILRKSDMLEKEQVAHIRAERD
I
LVEADGAWVVKMFYSFQDKRNLYLIMEFLPG
GDMMTLLMKKDTLTEEETQFYISETVLAIDAIHQLGFI
H
RDIKPDNLLLDAK
GHVKLSDFGLCTGLKKAHRTEFYRNLTHNPPSDFSFQNMNSKRKAETWKKNRRQLA
Y
STVGTPDYIAPEVFMQTGYNKLCDWWSLGVIMYEMLI
GYPPFCSETPQETYRKVMNWKETLVFPPEVPI
S
EKAKDLIL
RFCIDSENRIGNSGVEEIKGHPFFEGVDWEHIRERPAAIPIEIKSIDDTSNFDDFPESDIL
Q
P
VPNTTEPDYKSKDWVFLNYTYKRFEGLTQRGSIPTYMKAGKL



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser