NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS31574.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
31574.1 Public Homo sapiens 11 PGA3 22 109 92 CCDS HistoryNCBI Gene:643834Re-query CCDS DB by CCDS ID:31574.1Re-query CCDS DB by GeneID:643834See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 3, NCBI annotation release 36.2, Ensembl annotation release 41

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 31574.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000325558.10 ENSP00000322192.6 Accepted alive Link to Ensembl Transcript Viewer:ENST00000325558.10Link to Ensembl Protein Viewer:ENSP00000322192.6Re-query CCDS DB by Nucleotide ID:ENST00000325558Re-query CCDS DB by Protein ID:ENSP00000322192
Original member NCBI NM_001079807.3 NP_001073275.1 Updated not alive Link to Nucleotide Sequence:NM_001079807.3Link to Protein Sequence:NP_001073275.1Re-query CCDS DB by Nucleotide ID:NM_001079807Re-query CCDS DB by Protein ID:NP_001073275
Current member NCBI NM_001079807.4 NP_001073275.1 Accepted alive Link to Nucleotide Sequence:NM_001079807.4Link to Protein Sequence:NP_001073275.1Re-query CCDS DB by Nucleotide ID:NM_001079807Re-query CCDS DB by Protein ID:NP_001073275Link to BLAST:NP_001073275.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001073275.1 388 P0DJD8 388 100% 0 0

Chromosomal Locations for CCDS 31574.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 11 (NC_000011.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 61203565 61203620 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 61204107 61204269 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 61206510 61206627 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 61207497 61207615 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 61208291 61208490 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 61209842 61209958 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 61211090 61211234 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 61211337 61211435 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 61212553 61212702 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1167 nt):
ATGAAGTGGCTGCTGCTGCTGGGTCTGGTGGCACTCTCTGAGTGCATCATGTACAAGGTCCCCCTCATCA
GA
AAGAAGTCCTTGAGGCGCACCCTGTCCGAGCGTGGCCTGCTGAAGGACTTCCTGAAGAAGCACAACCT
C
AACCCAGCCAGAAAGTACTTCCCCCAGTGGAAGGCTCCCACCCTGGTAGATGAACAGCCCCTGGAGAAC
TAC
CTGGATATGGAGTACTTCGGCACTATCGGCATCGGAACTCCTGCCCAGGATTTCACCGTCGTCTTTG
AC
ACCGGCTCCTCCAACCTGTGGGTGCCCTCAGTCTACTGCTCCAGTCTTGCCTGCACCAACCACAACCG
C
TTCAACCCTGAGGATTCTTCCACCTACCAGTCCACCAGCGAGACAGTCTCCATCACCTACGGCACCGGC
AGC
ATGACAGGCATCCTCGGATACGACACTGTCCAGGTTGGAGGCATCTCTGACACCAATCAGATCTTCG
GC
CTGAGCGAGACGGAACCTGGCTCCTTCCTGTATTATGCTCCCTTCGATGGCATCCTGGGGCTGGCCTA
C
CCCAGCATTTCCTCCTCCGGGGCCACACCCGTCTTTGACAACATCTGGAACCAGGGCCTGGTTTCTCAG
GAC
CTCTTCTCTGTCTACCTCAGCGCCGATGACCAGAGTGGCAGCGTGGTGATCTTTGGTGGCATTGACT
CT
TCTTACTACACTGGAAGTCTGAACTGGGTGCCTGTTACCGTCGAGGGTTACTGGCAGATCACCGTGGA
C
AGCATCACCATGAACGGAGAGGCCATCGCCTGCGCTGAGGGCTGCCAGGCCATTGTTGACACCGGCACC
TCT
CTGCTGACCGGCCCAACCAGCCCCATTGCCAACATCCAGAGCGACATCGGAGCCAGCGAGAACTCAG
AT
GGCGACATGGTGGTCAGCTGCTCAGCCATCAGCAGCCTGCCCGACATCGTCTTCACCATCAATGGAGT
C
CAGTACCCCGTGCCACCCAGTGCCTACATCCTGCAGAGCGAGGGGAGCTGCATCAGTGGCTTCCAGGGC
ATG
AACCTCCCCACCGAATCTGGAGAGCTTTGGATCCTGGGTGATGTCTTCATCCGCCAGTACTTTACCG
TC
TTCGACAGGGCAAACAACCAGGTCGGCCTGGCCCCCGTGGCTTAA


Translation (388 aa):
MKWLLLLGLVALSECIMYKVPLIRKKSLRRTLSERGLLKDFLKKHNLNPARKYFPQWKAPTLVDEQPLEN
Y
LD
MEYFGTIGIGTPAQDFTVVFDTGSSNLWVPSVYCSSLACTNHNRFNPEDSSTYQSTSETVSITYGTG
S
MTGILGYDTVQ
VGGISDTNQIFGLSETEPGSFLYYAPFDGILGLAYPSISSSGATPVFDNIWNQGLVSQ
D
LFSVYLS
ADDQSGSVVIFGGIDSSYYTGSLNWVPVTVEGYWQITVDSITMNGEAIACAEGCQAIVDTGT
S
LLTGPTSPIANIQSDIGASENSDGD
MVVSCSAISSLPDIVFTINGVQYPVPPSAYILQSEGSCISGFQG
M
NLPTESGELWILGDVFIRQYFTVFDRANNQVGLAPVA




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser