NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS30981.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
30981.1 Public Homo sapiens 1 REN 22 109 92 CCDS HistoryNCBI Gene:5972Re-query CCDS DB by CCDS ID:30981.1Re-query CCDS DB by GeneID:5972See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 3, NCBI annotation release 36.2, Ensembl annotation release 41

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 30981.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000272190.8 ENSP00000272190.8 Accepted alive Link to Ensembl Transcript Viewer:ENST00000272190.8Link to Ensembl Protein Viewer:ENSP00000272190.8Re-query CCDS DB by Nucleotide ID:ENST00000272190Re-query CCDS DB by Protein ID:ENSP00000272190
Original member Current member NCBI NM_000537.3 NP_000528.1 Accepted alive Link to Nucleotide Sequence:NM_000537.3Link to Protein Sequence:NP_000528.1Re-query CCDS DB by Nucleotide ID:NM_000537Re-query CCDS DB by Protein ID:NP_000528Link to BLAST:NP_000528.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_000528.1 406 P00797-1 406 100% 0 0

Chromosomal Locations for CCDS 30981.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 1 (NC_000001.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 204155016 204155177 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 204155820 204155918 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 204156178 204156319 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 204156677 204156796 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 204157361 204157369 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 204159399 204159595 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 204160560 204160678 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 204161292 204161415 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 204162013 204162163 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 204166196 204166293 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1221 nt):
ATGGATGGATGGAGAAGGATGCCTCGCTGGGGACTGCTGCTGCTGCTCTGGGGCTCCTGTACCTTTGGTC
TC
CCGACAGACACCACCACCTTTAAACGGATCTTCCTCAAGAGAATGCCCTCAATCCGAGAAAGCCTGAA
G
GAACGAGGTGTGGACATGGCCAGGCTTGGTCCCGAGTGGAGCCAACCCATGAAGAGGCTGACACTTGGC
AAC
ACCACCTCCTCCGTGATCCTCACCAACTACATGGACACCCAGTACTATGGCGAGATTGGCATCGGCA
CC
CCACCCCAGACCTTCAAAGTCGTCTTTGACACTGGTTCGTCCAATGTTTGGGTGCCCTCCTCCAAGTG
C
AGCCGTCTCTACACTGCCTGTGTGTATCACAAGCTCTTCGATGCTTCGGATTCCTCCAGCTACAAGCAC
AAT
GGAACAGAACTCACCCTCCGCTATTCAACAGGGACAGTCAGTGGCTTTCTCAGCCAGGACATCATCA
CC
GTGGGTGGAATCACGGTGACACAGATGTTTGGAGAGGTCACGGAGATGCCCGCCTTACCCTTCATGCT
G
GCCGAGTTTGATGGGGTTGTGGGCATGGGCTTCATTGAACAGGCCATTGGCAGGGTCACCCCTATCTTC
GAC
AACATCATCTCCCAAGGGGTGCTAAAAGAGGACGTCTTCTCTTTCTACTACAACAGAGATTCCGAGA
AT
TCCCAATCGCTGGGAGGACAGATTGTGCTGGGAGGCAGCGACCCCCAGCATTACGAAGGGAATTTCCA
C
TATATCAACCTCATCAAGACTGGTGTCTGGCAGATTCAAATGAAGGGGGTGTCTGTGGGGTCATCCACC
TTG
CTCTGTGAAGACGGCTGCCTGGCATTGGTAGACACCGGTGCATCCTACATCTCAGGTTCTACCAGCT
CC
ATAGAGAAGCTCATGGAGGCCTTGGGAGCCAAGAAGAGGCTGTTTGATTATGTCGTGAAGTGTAACGA
G
GGCCCTACACTCCCCGACATCTCTTTCCACCTGGGAGGCAAAGAATACACGCTCACCAGCGCGGACTAT
GTA
TTTCAGGAATCCTACAGTAGTAAAAAGCTGTGCACACTGGCCATCCACGCCATGGATATCCCGCCAC
CC
ACTGGACCCACCTGGGCCCTGGGGGCCACCTTCATCCGAAAGTTCTACACAGAGTTTGATCGGCGTAA
C
AACCGCATTGGCTTCGCCTTGGCCCGCTGA


Translation (406 aa):
MDGWRRMPRWGLLLLLWGSCTFGLPTDTTTFKRIFLKRMPSIRESLKERGVDMARLGPEWSQPMKRLTLG
N
TTSSVILTNYMD
TQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKH
N
GTELTLRYSTGTVSGFLSQDIIT
VGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIF
D
NIISQGVLKEDVFSFYYN
RDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSST
L
LCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFD
YVVKCNEGPTLPDISFHLGGKEYTLTSADY
V
FQ
ESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser