NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS30649.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
30649.1 Public Homo sapiens 1 RPS6KA1 22 109 92 CCDS HistoryNCBI Gene:6195Re-query CCDS DB by CCDS ID:30649.1Re-query CCDS DB by GeneID:6195See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 3, NCBI annotation release 36.2, Ensembl annotation release 41

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 30649.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000531382.5 ENSP00000435412.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000531382.5Link to Ensembl Protein Viewer:ENSP00000435412.1Re-query CCDS DB by Nucleotide ID:ENST00000531382Re-query CCDS DB by Protein ID:ENSP00000435412
Original member Current member NCBI NM_001006665.1 NP_001006666.1 Accepted alive Link to Nucleotide Sequence:NM_001006665.1Link to Protein Sequence:NP_001006666.1Re-query CCDS DB by Nucleotide ID:NM_001006665Re-query CCDS DB by Protein ID:NP_001006666Link to BLAST:NP_001006666.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001006666.1 744 Q15418-2 744 100% 0 0

Chromosomal Locations for CCDS 30649.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 1 (NC_000001.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 26545901 26546035 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 26546867 26546983 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 26547189 26547270 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 26551397 26551477 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 26551644 26551723 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 26553391 26553497 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 26554214 26554251 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 26554596 26554738 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 26555151 26555221 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 26555537 26555625 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 26556654 26556718 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 26556998 26557100 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 26558807 26558937 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 26560726 26560851 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 26561045 26561134 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 26561505 26561663 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 26571449 26571610 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 26571849 26571925 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 26572176 26572293 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 26573224 26573361 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 26574079 26574201 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2235 nt):
ATGGAGCAGGATCCCAAGCCGCCCCGTCTGCGGCTCTGGGCCCTGATCCCCTGGCTTCCCAGGAAGCAGC
GG
CCCAGGATCAGCCAGACCTCTCTGCCTGTCCCTGGCCCTGGCTCTGGCCCCCAGCGGGACTCGGATGA
G
GGCGTCCTCAAGGAGATCTCCATCACGCACCACGTCAAGGCTGGCTCTGAGAAGGCTGATCCATCCCAT
TTC
GAGCTCCTCAAGGTTCTGGGCCAGGGATCCTTTGGCAAAGTCTTCCTGGTGCGGAAAGTCACCCGGC
CT
GACAGTGGGCACCTGTATGCTATGAAGGTGCTGAAGAAGGCAACGCTGAAAGTACGTGACCGCGTCCG
G
ACCAAGATGGAGAGAGACATCCTGGCTGATGTAAATCACCCATTCGTGGTGAAGCTGCACTATGCCTTC
CAG
ACCGAGGGCAAGCTCTATCTCATTCTGGACTTCCTGCGTGGTGGGGACCTCTTCACCCGGCTCTCAA
AA
GAGGTGATGTTCACGGAGGAGGATGTGAAGTTTTACCTGGCTGAGCTGGCTCTGGGCCTGGATCACCT
G
CACAGCCTGGGTATCATTTACAGAGACCTCAAGCCTGAGAACATCCTTCTGGATGAGGAGGGCCACATC
AAA
CTCACTGACTTTGGCCTGAGCAAAGAGGCCATTGACCACGAGAAGAAGGCCTATTCTTTCTGCGGGA
CA
GTGGAGTACATGGCCCCTGAGGTCGTCAACCGCCAGGGCCACTCCCATAGTGCGGACTGGTGGTCCTA
T
GGGGTGTTGATGTTTGAGATGCTGACGGGCTCCCTGCCCTTCCAGGGGAAGGACCGGAAGGAGACCATG
ACA
CTGATTCTGAAGGCGAAGCTAGGCATGCCCCAGTTTCTGAGCACTGAAGCCCAGAGCCTCTTGCGGG
CC
CTGTTCAAGCGGAATCCTGCCAACCGGCTCGGCTCCGGCCCTGATGGGGCAGAGGAAATCAAGCGGCA
T
GTCTTCTACTCCACCATTGACTGGAATAAGCTATACCGTCGTGAGATCAAGCCACCCTTCAAGCCAGCA
GTG
GCTCAGCCTGATGACACCTTCTACTTTGACACCGAGTTCACGTCCCGCACACCCAAGGATTCCCCAG
GC
ATCCCCCCCAGCGCTGGGGCCCATCAGCTGTTCCGGGGCTTCAGCTTCGTGGCCACCGGCCTGATGGA
A
GACGACGGCAAGCCTCGTGCCCCGCAGGCACCCCTGCACTCGGTGGTACAGCAACTCCATGGGAAGAAC
CTG
GTTTTTAGTGACGGCTACGTGGTAAAGGAGACAATTGGTGTGGGCTCCTACTCTGAGTGCAAGCGCT
GT
GTCCACAAGGCCACCAACATGGAGTATGCTGTCAAGGTCATTGATAAGAGCAAGCGGGATCCTTCAGA
A
GAGATTGAGATTCTTCTGCGGTATGGCCAGCACCCCAACATCATCACTCTGAAAGATGTGTATGATGAT
GGC
AAACACGTGTACCTGGTGACAGAGCTGATGCGGGGTGGGGAGCTGCTGGACAAGATCCTGCGGCAGA
AG
TTCTTCTCAGAGCGGGAGGCCAGCTTTGTCCTGCACACCATTGGCAAAACTGTGGAGTATCTGCACTC
A
CAGGGGGTTGTGCACAGGGACCTGAAGCCCAGCAACATCCTGTATGTGGACGAGTCCGGGAATCCCGAG
TGC
CTGCGCATCTGTGACTTTGGTTTTGCCAAACAGCTGCGGGCTGAGAATGGGCTCCTCATGACACCTT
GC
TACACAGCCAACTTTGTGGCGCCTGAGGTGCTGAAGCGCCAGGGCTACGATGAAGGCTGCGACATCTG
G
AGCCTGGGCATTCTGCTGTACACCATGCTGGCAGGATATACTCCATTTGCCAACGGTCCCAGTGACACA
CCA
GAGGAAATCCTAACCCGGATCGGCAGTGGGAAGTTTACCCTCAGTGGGGGAAATTGGAACACAGTTT
CA
GAGACAGCCAAGGACCTGGTGTCCAAGATGCTACACGTGGATCCCCACCAGCGCCTCACAGCTAAGCA
G
GTTCTGCAGCATCCATGGGTCACCCAGAAAGACAAGCTTCCCCAAAGCCAGCTGTCCCACCAGGACCTA
CAG
CTTGTGAAGGGAGCCATGGCTGCCACGTACTCCGCACTCAACAGCTCCAAGCCCACCCCCCAGCTGA
AG
CCCATCGAGTCATCCATCCTGGCCCAGCGGCGAGTGAGGAAGTTGCCATCCACCACCCTGTGA


Translation (744 aa):
MEQDPKPPRLRLWALIPWLPRKQRPRISQTSLPVPGPGSGPQRDSDEGVLKEISITHHVKAGSEKADPSH
F
ELLKVLGQGSFGK
VFLVRKVTRPDSGHLYAMKVLKKATLKVRDRVRTKMERDILADVNHPFVVKLHYAF
Q
TEGKLYLILDFLRGGDLFTRLSKE
VMFTEEDVKFYLAELALGLDHLHSLGIIYRDLKPENILLDEEGHI
K
LT
DFGLSKEAIDHEKKAYSFCGTVEYMAPEVVNRQGHSHSADWWSYGVLMFEMLTGSLPFQGKDRKETM
T
LIL
KAKLGMPQFLSTEAQSLLRALFKRNPANRLGSGPDGAEEIKRHVFYSTIDWNKLYRREIKPPFKPA
V
AQPDDTFYFDTEFTSRTPK
DSPGIPPSAGAHQLFRGFSFVATGLMEDDGKPRAPQAPLHSVVQQLHGKN
L
VFSDGYVVKETIGVGSYSECKRCVHKATNMEYAVK
VIDKSKRDPSEEIEILLRYGQHPNIITLKDVYDD
G
KHVYLVTELMRGGELLDKILRQKFFSEREASFVLHTIGKTVEYLHSQG
VVHRDLKPSNILYVDESGNPE
C
LRICDFGFAKQLRAENGLLMTPCYTANFVAPE
VLKRQGYDEGCDIWSLGILLYTMLAGYTPFANGPSDT
P
EEILTRIGSGKFTLSGGNWNTVSETAK
DLVSKMLHVDPHQRLTAKQVLQHPWVTQKDKLPQSQLSHQDL
Q
LVK
GAMAATYSALNSSKPTPQLKPIESSILAQRRVRKLPSTTL



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser