NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
The CCDS database will be unavailable on Tuesday, June 25, 2024, starting at 8:00 a.m. EDT for up to 60 minutes.
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS3047.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
3047.1 Public Homo sapiens 3 RUVBL1 24 110 108 CCDS HistoryNCBI Gene:8607Re-query CCDS DB by CCDS ID:3047.1Re-query CCDS DB by GeneID:8607See the combined annotation on chromosome 3 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 3047.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000322623.10 ENSP00000318297.5 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000322623.10Link to Ensembl Protein Viewer:ENSP00000318297.5Re-query CCDS DB by Nucleotide ID:ENST00000322623Re-query CCDS DB by Protein ID:ENSP00000318297
Original member Current member NCBI NM_003707.3 NP_003698.1 MANE Select Accepted alive Link to Nucleotide Sequence:NM_003707.3Link to Protein Sequence:NP_003698.1Re-query CCDS DB by Nucleotide ID:NM_003707Re-query CCDS DB by Protein ID:NP_003698Link to BLAST:NP_003698.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_003698.1 456 Q9Y265-1 456 100% 0 0

Chromosomal Locations for CCDS 3047.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '-' strand of Chromosome 3 (NC_000003.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3See the combined annotation on chromosome 3 in Sequence Viewer

Chromosome Start Stop Links
3 128081250 128081409 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 128082483 128082574 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 128087706 128087808 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 128097300 128097498 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 128098882 128098945 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 128100595 128100744 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 128101559 128101648 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 128104773 128104924 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 128112888 128113020 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 128119328 128119414 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 128123584 128123724 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1371 nt):
ATGAAGATTGAGGAGGTGAAGAGCACTACGAAGACGCAGCGCATCGCCTCCCACAGCCACGTGAAAGGGC
TG
GGGCTGGACGAGAGCGGCTTGGCCAAGCAGGCGGCCTCAGGGCTTGTGGGCCAGGAGAACGCGCGAGA
G
GCATGTGGCGTCATAGTAGAATTAATCAAAAGCAAGAAAATGGCTGGAAGAGCTGTCTTGTTGGCAGGA
CCT
CCTGGAACTGGCAAGACAGCTCTGGCTCTGGCTATTGCTCAGGAGCTGGGTAGTAAGGTCCCCTTCT
GC
CCAATGGTGGGGAGTGAAGTTTACTCAACTGAGATCAAGAAGACAGAGGTGCTGATGGAGAACTTCCG
C
AGGGCCATTGGGCTGCGAATAAAGGAGACCAAGGAAGTTTATGAAGGTGAAGTCACAGAGCTAACTCCG
TGT
GAGACAGAGAATCCCATGGGAGGATATGGCAAAACCATTAGCCATGTGATCATAGGACTCAAAACAG
CC
AAAGGAACCAAACAGTTGAAACTGGACCCCAGCATTTTTGAAAGTTTGCAGAAAGAGCGAGTAGAAGC
T
GGAGATGTGATTTACATTGAAGCCAACAGTGGGGCCGTGAAGAGGCAGGGCAGGTGTGATACCTATGCC
ACA
GAATTCGACCTTGAAGCTGAAGAGTATGTCCCCTTGCCAAAAGGGGATGTGCACAAAAAGAAAGAAA
TC
ATCCAAGATGTGACCTTGCATGACTTGGATGTGGCTAATGCGCGGCCCCAGGGGGGACAAGATATCCT
G
TCCATGATGGGCCAGCTAATGAAGCCAAAGAAGACAGAAATCACAGACAAACTTCGAGGGGAGATTAAT
AAG
GTGGTGAACAAGTACATCGACCAGGGCATTGCTGAGCTGGTCCCGGGTGTGCTGTTTGTTGATGAGG
TC
CACATGCTGGACATTGAGTGCTTCACCTACCTGCACCGCGCCCTGGAGTCTTCTATCGCTCCCATCGT
C
ATCTTTGCATCCAACCGAGGCAACTGTGTCATCAGAGGCACTGAGGACATCACATCCCCTCACGGCATC
CCT
CTTGACCTTCTGGACCGAGTGATGATAATCCGGACCATGCTGTATACTCCACAGGAAATGAAACAGA
TC
ATTAAAATCCGTGCCCAGACGGAAGGAATCAACATCAGTGAGGAGGCACTGAACCACCTGGGGGAGAT
T
GGCACCAAGACCACACTGAGGTACTCAGTGCAGCTGCTGACCCCGGCCAACTTGCTTGCTAAAATCAAC
GGG
AAGGACAGCATTGAGAAAGAGCATGTCGAAGAGATCAGTGAACTTTTCTATGATGCCAAGTCCTCCG
CC
AAAATCCTGGCTGACCAGCAGGATAAGTACATGAAGTGA


Translation (456 aa):
MKIEEVKSTTKTQRIASHSHVKGLGLDESGLAKQAASGLVGQENAREACGVIVELIKSKKMAGRAVLLAG
P
PGTGK
TALALAIAQELGSKVPFCPMVGSEVYSTEIKKTEVLMENFRRAIGLRIKETKEVYEGEVTELTP
C
ETENPMGGYGKTISHVIIGLKTAKGTKQLK
LDPSIFESLQKERVEAGDVIYIEANSGAVKRQGRCDTYA
T
EFDLEAEEYVPLPKGDVHKKKEIIQDVTLHDLDVANARPQ
GGQDILSMMGQLMKPKKTEITDKLRGEIN
K
VVNKYIDQGIAELVPGVLFVDEVHMLDIECFTYLHRALESSIAPIVIFASNRGNCVI
RGTEDITSPHGI
P
LDLLDRVMIIRTMLYTPQEMKQ
IIKIRAQTEGINISEEALNHLGEIGTKTTLRYSVQLLTPANLLAKIN
G
KDSIEKEHVEEISELFYDAKSSAKILADQQDKYMK




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser