NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS30439.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
30439.1 Public Mus musculus X Prps1 21 106 86 CCDS HistoryNCBI Gene:19139Re-query CCDS DB by CCDS ID:30439.1Re-query CCDS DB by GeneID:19139See the combined annotation on chromosome X in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 30439.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000033809 ENSMUSP00000033809 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000033809Link to Ensembl Protein Viewer:ENSMUSP00000033809Re-query CCDS DB by Nucleotide ID:ENSMUST00000033809Re-query CCDS DB by Protein ID:ENSMUSP00000033809
Original member Current member EBI,WTSI OTTMUST00000045356 OTTMUSP00000020407 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000045356Link to Vega Protein Viewer:OTTMUSP00000020407Re-query CCDS DB by Nucleotide ID:OTTMUST00000045356Re-query CCDS DB by Protein ID:OTTMUSP00000020407
Original member Current member NCBI NM_021463.4 NP_067438.1 Accepted alive Link to Nucleotide Sequence:NM_021463.4Link to Protein Sequence:NP_067438.1Re-query CCDS DB by Nucleotide ID:NM_021463Re-query CCDS DB by Protein ID:NP_067438Link to BLink:NP_067438.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_067438.1 318 Q9D7G0 318 100% 0 0

Chromosomal Locations for CCDS 30439.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome X (NC_000086.7)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome XLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome XSee the combined annotation on chromosome X in Sequence Viewer

Chromosome Start Stop Links
X 140456742 140456863 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 140465231 140465414 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 140467672 140467770 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 140468835 140468959 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 140471997 140472170 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 140473779 140473938 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 140475169 140475261 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (957 nt):
ATGCCGAATATCAAAATCTTCAGCGGGAGCTCCCACCAGGACTTATCCCAGAAAATCGCTGACCGCCTGG
GC
CTTGAGCTAGGCAAGGTGGTGACTAAGAAATTCAGCAACCAGGAGACCTGTGTGGAAATTGGCGAAAG
C
GTTCGTGGAGAAGATGTCTACATTGTTCAAAGTGGGTGTGGTGAGATAAATGACAATCTAATGGAGCTT
TTG
ATCATGATTAATGCTTGTAAGATCGCTTCAGCCAGCCGGGTTACTGCAGTCATCCCATGCTTCCCTT
AC
GCCCGCCAAGATAAGAAGGATAAGAGCCGGGCTCCAATCTCAGCTAAGCTTGTTGCAAATATGCTATC
T
GTAGCAGGTGCAGATCATATTATCACCATGGATCTACATGCATCTCAAATTCAGGGTTTCTTTGATATC
CCG
GTGGACAATTTATATGCAGAGCCAGCTGTCCTAAAGTGGATACGGGAGAATATATCTGAGTGGAGAA
AC
TGTACTATTGTCTCACCTGATGCTGGTGGAGCCAAAAGAGTGACCTCCATTGCAGACCGGCTGAATGT
G
GATTTTGCTTTGATTCACAAGGAACGGAAGAAGGCCAATGAAGTGGACCGCATGGTACTTGTGGGAGAT
GTG
AAGGACCGTGTGGCTATACTTGTGGATGACATGGCTGACACTTGCGGTACAATCTGTCACGCCGCTG
AC
AAACTTCTCTCAGCTGGCGCTACCAGAGTTTATGCTATCTTGACGCATGGAATCTTTTCTGGCCCTGC
C
ATTTCTCGAATCAACAATGCATGCTTTGAAGCAGTAGTAGTTACCAATACCATACCTCAGGAGGACAAG
ATG
AAACACTGCTCCAAGATACAGGTGATTGACATCTCTATGATCCTTGCAGAAGCCATCAGGAGAACCC
AC
AATGGAGAATCTGTCTCCTACTTGTTCAGCCATGTTCCTTTATAA


Translation (318 aa):
MPNIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMEL
L
IMINACKIASASRVTAVIPCFPYARQDKKDK
SRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDI
P
VDNLYAEPAVLKWIRENISEWRNCTIVSPDAGGAK
RVTSIADRLNVDFALIHKERKKANEVDRMVLVGD
V
KDRVAILVDDMADTCGTICHAAD
KLLSAGATRVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEDK
M
KHCSKIQ
VIDISMILAEAIRRTHNGESVSYLFSHVPL



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser