NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
The CCDS database will be unavailable on Tuesday, June 28, 2022, starting at 8:00 a.m. EDT for up to 60 minutes.
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS3022.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
3022.1 Public Homo sapiens 3 ADCY5 22 109 92 CCDS HistoryNCBI Gene:111Re-query CCDS DB by CCDS ID:3022.1Re-query CCDS DB by GeneID:111See the combined annotation on chromosome 3 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 3022.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000462833.5 ENSP00000419361.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000462833.5Link to Ensembl Protein Viewer:ENSP00000419361.1Re-query CCDS DB by Nucleotide ID:ENST00000462833Re-query CCDS DB by Protein ID:ENSP00000419361
Original member NCBI NM_183357.2 NP_899200.1 Updated not alive Link to Nucleotide Sequence:NM_183357.2Link to Protein Sequence:NP_899200.1Re-query CCDS DB by Nucleotide ID:NM_183357Re-query CCDS DB by Protein ID:NP_899200
Current member NCBI NM_183357.3 NP_899200.1 Accepted alive Link to Nucleotide Sequence:NM_183357.3Link to Protein Sequence:NP_899200.1Re-query CCDS DB by Nucleotide ID:NM_183357Re-query CCDS DB by Protein ID:NP_899200Link to BLAST:NP_899200.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_899200.1 1261 O95622-1 1261 100% 0 0

Chromosomal Locations for CCDS 3022.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 3 (NC_000003.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3See the combined annotation on chromosome 3 in Sequence Viewer

Chromosome Start Stop Links
3 123284608 123284736 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 123286685 123286809 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 123289750 123289954 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 123291113 123291376 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 123296084 123296216 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 123297353 123297382 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 123300120 123300295 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 123303055 123303219 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 123304067 123304183 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 123314235 123314322 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 123318020 123318117 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 123319674 123319818 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 123320749 123320771 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 123325322 123325462 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 123327618 123327759 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 123328644 123328802 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 123330889 123331016 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 123332564 123332675 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 123347782 123347903 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 123352432 123352581 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 123447412 123448545 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3786 nt):
ATGTCCGGCTCCAAAAGCGTGAGCCCCCCGGGCTACGCGGCGCAGAAGACTGCGGCGCCGGCGCCCCGGG
GA
GGCCCCGAACACCGCTCTGCGTGGGGCGAGGCCGATTCCCGCGCGAATGGCTACCCCCATGCCCCCGG
G
GGCTCTGCCCGCGGCTCCACCAAGAAACCCGGGGGGGCGGTGACCCCGCAGCAGCAGCAGCGCCTGGCC
AGC
CGCTGGCGCAGCGACGACGACGACGATCCTCCGCTGAGCGGTGACGACCCCCTGGCCGGGGGCTTCG
GC
TTCAGCTTCCGCTCCAAGTCCGCCTGGCAGGAGCGCGGCGGCGACGACTGCGGTCGCGGCAGCCGCCG
G
CAGCGGCGGGGCGCGGCCAGCGGGGGCAGCACCCGGGCGCCCCCTGCGGGCGGCGGCGGCGGCTCGGCG
GCG
GCGGCTGCCTCGGCGGGCGGGACGGAGGTGCGCCCTCGCTCGGTGGAGGTGGGTCTGGAGGAGCGGC
GG
GGCAAGGGGCGCGCGGCCGACGAGCTGGAGGCCGGCGCCGTCGAGGGCGGCGAGGGGTCCGGGGATGG
C
GGCAGCTCGGCGGACTCGGGCTCGGGCGCGGGGCCCGGCGCGGTGCTGTCCCTGGGCGCCTGCTGCCTG
GCG
TTGCTGCAGATATTCCGCTCCAAGAAGTTCCCGTCGGACAAACTGGAGCGGCTGTACCAGCGCTACT
TC
TTCCGCCTGAACCAGAGCAGCCTCACCATGCTCATGGCCGTGCTGGTGCTCGTGTGCCTGGTCATGTT
G
GCCTTCCACGCGGCGCGGCCCCCGCTCCAGCTGCCCTACCTGGCCGTGCTGGCGGCCGCCGTCGGCGTG
ATC
CTCATCATGGCTGTGCTTTGCAACCGCGCCGCCTTCCACCAGGACCACATGGGCCTGGCCTGCTATG
CG
CTCATCGCCGTGGTGCTGGCCGTCCAGGTGGTGGGCCTGCTGCTGCCGCAGCCACGCAGCGCCTCTGA
G
GGCATCTGGTGGACCGTGTTCTTCATCTACACCATCTACACGCTGCTGCCCGTGCGCATGCGGGCCGCA
GTG
CTCAGCGGGGTGCTCCTGTCCGCCCTCCACCTGGCCATCGCCCTGCGCACCAACGCCCAGGACCAGT
TC
CTGCTGAAGCAGCTTGTCTCCAATGTTCTCATTTTCTCCTGCACCAACATCGTGGGTGTCTGCACCCA
C
TATCCGGCTGAGGTCTCCCAGAGACAGGCTTTCCAGGAGACCCGAGAGTGCATCCAGGCGCGGCTCCAC
TCG
CAGCGGGAGAACCAGCAGCAGGAACGGCTCCTGCTGTCTGTCCTTCCCCGTCATGTTGCCATGGAGA
TG
AAAGCAGACATCAACGCCAAGCAGGAGGATATGATGTTCCATAAGATTTACATCCAGAAACATGACAA
C
GTGAGCATCCTGTTTGCTGACATCGAGGGCTTCACCAGCCTGGCGTCCCAGTGCACTGCACAGGAACTG
GTC
ATGACCCTCAACGAGCTCTTCGCCCGCTTTGACAAGCTGGCCGCAGAGAATCACTGTTTACGTATTA
AG
ATCCTTGGGGATTGTTATTACTGCGTCTCGGGGCTGCCTGAAGCAAGGGCTGACCACGCCCACTGCTG
T
GTGGAGATGGGCATGGACATGATCGAGGCCATCTCGTTGGTCCGGGAGGTGACAGGGGTGAACGTGAAC
ATG
CGTGTGGGAATTCACAGCGGGCGAGTACACTGCGGTGTCCTTGGTCTCAGGAAGTGGCAGTTCGACG
TC
TGGTCTAACGATGTCACGCTAGCCAACCACATGGAGGCTGGCGGCAAGGCAGGACGCATCCACATCAC
C
AAGGCTACACTCAACTACCTGAATGGGGACTACGAGGTGGAGCCAGGCTGTGGGGGCGAGCGCAACGCC
TAC
CTCAAGGAGCACAGTATCGAGACCTTCCTCATCCTGCGCTGCACCCAGAAGCGGAAAGAAGAGAAGG
CC
ATGATCGCCAAGATGAACCGCCAGAGAACCAACTCCATCGGGCACAACCCACCACACTGGGGGGCTGA
G
CGCCCCTTCTACAACCACCTGGGTGGCAACCAGGTGTCCAAGGAGATGAAGCGGATGGGCTTTGAAGAC
CCC
AAGGACAAGAACGCCCAGGAGAGTGCGAACCCTGAGGATGAAGTGGATGAGTTTCTGGGCCGTGCCA
TT
GACGCCAGGAGCATTGATAGGCTTCGGTCTGAGCACGTCCGCAAGTTCCTCCTGACCTTCAGGGAGCC
T
GACTTAGAGAAGAAGTACTCCAAGCAGGTAGACGACCGATTTGGTGCCTATGTGGCGTGTGCCTCGCTC
GTC
TTCCTCTTCATCTGCTTTGTCCAGATCACCATCGTGCCCCACTCCATATTCATGCTCAGCTTCTACC
TG
ACCTGTTCCCTGCTGCTGACCTTGGTGGTGTTTGTGTCTGTGATCTACTCCTGCGTAAAGCTCTTCCC
C
TCCCCACTGCAGACCCTCTCCAGGAAGATCGTGCGGTCCAAGATGAACAGCACCCTGGTTGGGGTGTTC
ACC
ATCACCCTGGTGTTCCTGGCGGCTTTTGTCAACATGTTCACGTGCAACTCCAGGGACCTGCTGGGCT
GC
TTGGCACAGGAGCACAACATCAGCGCGAGCCAGGTCAACGCGTGTCACGTGGCGGAGTCGGCCGTCAA
C
TACAGCCTGGGCGATGAGCAGGGCTTCTGTGGCAGCCCCTGGCCCAACTGCAACTTCCCCGAGTACTTC
ACC
TACAGCGTGCTGCTCAGCCTGCTGGCCTGCTCCGTGTTCCTGCAGATCAGCTGCATCGGGAAGCTGG
TG
CTCATGCTGGCCATCGAGCTCATCTACGTGCTCATCGTGGAGGTGCCAGGTGTCACGCTCTTCGACAA
C
GCCGACCTGCTGGTCACCGCCAACGCCATAGACTTCTTCAACAACGGGACCTCCCAGTGCCCTGAGCAT
GCA
ACCAAGGTGGCATTGAAGGTGGTGACGCCCATCATCATCTCAGTCTTTGTGCTGGCCCTGTACCTGC
AC
GCCCAGCAGGTGGAGTCCACTGCCCGCCTCGACTTCCTCTGGAAACTGCAGGCCACAGAGGAGAAAGA
G
GAGATGGAGGAGCTGCAGGCCTACAACCGGCGGCTGCTGCACAACATCCTGCCCAAGGACGTGGCCGCT
CAC
TTCCTGGCCCGCGAGCGGCGCAATGATGAGCTCTACTATCAGTCCTGTGAGTGTGTGGCGGTCATGT
TC
GCCTCCATCGCCAACTTCTCCGAGTTCTACGTTGAGCTGGAGGCCAACAACGAGGGTGTCGAGTGCCT
G
CGGCTACTCAATGAGATCATCGCTGACTTTGATGAGATCATCAGCGAGGATCGGTTCCGGCAGCTGGAG
AAG
ATCAAGACCATCGGCAGCACCTACATGGCTGCCTCCGGCCTCAACGACTCTACCTACGACAAGGTGG
GC
AAGACCCACATCAAGGCACTGGCCGACTTTGCCATGAAGCTGATGGACCAGATGAAGTACATCAATGA
G
CACTCCTTCAACAACTTCCAGATGAAGATCGGGCTCAACATCGGCCCCGTGGTGGCCGGGGTGATAGGG
GCA
CGAAAGCCTCAGTACGACATCTGGGGCAATACCGTGAACGTGGCCAGCCGCATGGACAGCACCGGTG
TA
CCCGACCGCATCCAGGTCACCACAGACATGTACCAGGTGCTGGCTGCCAACACGTACCAGCTGGAGTG
C
CGGGGCGTGGTCAAGGTCAAGGGCAAAGGCGAGATGATGACCTACTTCCTCAATGGAGGGCCCCCGCTC
AGT
TAG


Translation (1261 aa):
MSGSKSVSPPGYAAQKTAAPAPRGGPEHRSAWGEADSRANGYPHAPGGSARGSTKKPGGAVTPQQQQRLA
S
RWRSDDDDDPPLSGDDPLAGGFGFSFRSKSAWQERGGDDCGRGSRRQRRGAASGGSTRAPPAGGGGGSA
A
AAASAGGTEVRPRSVEVGLEERRGKGRAADELEAGAVEGGEGSGDGGSSADSGSGAGPGAVLSLGACCL
A
LLQIFRSKKFPSDKLERLYQRYFFRLNQSSLTMLMAVLVLVCLVMLAFHAARPPLQLPYLAVLAAAVGV
I
LIMAVLCNRAAFHQDHMGLACYALIAVVLAVQVVGLLLPQPRSASEGIWWTVFFIYTIYTLLPVRMRAA
V
LSGVLLSALHLAIALRTNAQDQFLLKQ
LVSNVLIFSCTNIVGVCTHYPAEVSQRQAFQETRECIQARLH
S
QRENQQQ
ERLLLSVLPRHVAMEMKADINAKQEDMMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQEL
V
MTLNELFARFDKLAA
ENHCLRIKILGDCYYCVSGLPEARADHAHCCVEMGMDMIEAISLVREVTGVNVN
M
RVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGKA
GRIHITKATLNYLNGDYEVEPGCGGERNA
Y
LKEHSIETFLILRCTQKR
KEEKAMIAKMNRQRTNSIGHNPPHWGAERPFYNHLGGNQVSKEMKRMGFED
P
KD
KNAQESANPEDEVDEFLGRAIDARSIDRLRSEHVRKFLLTFREPDLEKKYSKQVDDRFGAYVACASL
V
FLFICFVQITIVP
HSIFMLSFYLTCSLLLTLVVFVSVIYSCVKLFPSPLQTLSRKIVRSKMNSTLVGVF
T
ITLVFLAAFVNM
FTCNSRDLLGCLAQEHNISASQVNACHVAESAVNYSLGDEQGFCGSPWPNCNFPEYF
T
YSVLLSLLACSVFLQISCIGKLVLMLAIELIYVLIVEVPGVTLFDNADLLVTANA
IDFFNNGTSQCPEH
A
TKVALKVVTPIIISVFVLALYLHAQQVESTARLDFLWKLQ
ATEEKEEMEELQAYNRRLLHNILPKDVAA
H
FLARERRNDELYYQSCECVAVMFASIANFSEFYVELEANNEGVECLRLLNEIIADFDE
IISEDRFRQLE
K
IKTIGSTYMAASGLNDSTYDKVGKTHIKALADFAMKLMDQMKYINEHSFNNFQMKI
GLNIGPVVAGVIG
A
RKPQYDIWGNTVNVASRMDSTGVPDRIQ
VTTDMYQVLAANTYQLECRGVVKVKGKGEMMTYFLNGGPPL
S




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser