NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS30138.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
30138.1 Public Mus musculus X Zfp36l3 21 106 86 CCDS HistoryNCBI Gene:333473Re-query CCDS DB by CCDS ID:30138.1Re-query CCDS DB by GeneID:333473See the combined annotation on chromosome X in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 30138.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000071711 ENSMUSP00000071630 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000071711Link to Ensembl Protein Viewer:ENSMUSP00000071630Re-query CCDS DB by Nucleotide ID:ENSMUST00000071711Re-query CCDS DB by Protein ID:ENSMUSP00000071630
Original member Current member EBI,WTSI OTTMUST00000042176 OTTMUSP00000018953 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000042176Link to Vega Protein Viewer:OTTMUSP00000018953Re-query CCDS DB by Nucleotide ID:OTTMUST00000042176Re-query CCDS DB by Protein ID:OTTMUSP00000018953
Original member Current member NCBI NM_001009549.2 NP_001009549.1 Accepted alive Link to Nucleotide Sequence:NM_001009549.2Link to Protein Sequence:NP_001009549.1Re-query CCDS DB by Nucleotide ID:NM_001009549Re-query CCDS DB by Protein ID:NP_001009549Link to BLAST:NP_001009549.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001009549.1 725 Q5ISE2 725 100% 0 0

Chromosomal Locations for CCDS 30138.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome X (NC_000086.7)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome XSee the combined annotation on chromosome X in Sequence Viewer

Chromosome Start Stop Links
X 53774068 53776245 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2178 nt):
ATGGCCAACAACAATCTGAACCGCCCGCTCAACACTAATGTGGCTGATTCTTCCAACTCCAGCTCAACAC
CT
GGCACTGCTCCACCACCATCTTCCAGCGACCCCCAAGTGCTCGGCCACCAGGCTCCCAGTTCCAGTGC
C
TCCAGCCTCACCGAGGACTGCTCGTCCAGTTTTGCGAGAGACCTGAACAGCTACAATAATGGTCAGTCG
GGG
GCAACTGGTGCGGTGTCCTGGGAAGCTCCCCATGAGCCCTCAGAGGCTAACGCGGTGTCGCAGATCC
AC
CCGCGGAATGGCGAACATAGCCTGCAGCAGAAGCCTAAGCCACAGAAGGTGAGCGGCTCGAGCTCCCT
G
GCCACTTCTGAGCGCTATAAGACTGAGCTATGTCGGCCCTTTGAGGAAAGCGGCATTTGCAAGTATGGC
CAC
AAGTGCCAGTTCGCGCATGGCTACCGCGAACTGCGTACCCTGTCAAGGCACCCCAAGTACAAGACGG
AG
CCTTGCCGCACCTTCCACAGCGTTGGCTTTTGCCCCTATGGCACTCGCTGTCACTTCATTCACAACCA
G
CCCGAGCAGCAACCTGTGCTTTCCGAGAGCACCTTGGAGGAGCCCAGCTCCTTCAATGGCTCCAATGTG
CTG
CATTTGGGCGTTAACGGGGAGCAGCAGCCCGGACTGCAGAGTGACAGCCCTTCGGGCTTCCTGTCGG
TC
AACAGTCAAGCCCTCCAGGCACCTCTGCAGCTCAACCAGCAGGCGTTGAGCTCAGGCGGGGTTATGCC
C
TCATCACACCCTGCAGCCGCCAACCTCCGGATGATGTGCTGCAGAACATCATCCTCTACCACAGCCCAC
GAC
GCTGACAAAGACCCCGACAAAGATGCTGACAAAGACCCGAGCAACAACTCAGCCAACGATGCCCTCG
CC
TTCCCCCAGGAGCCAGGTGACTTCTCTCCTGTGGCATTCCAGAACCCTAACACTGCTACCACGACTCC
C
ACTGCCTTCTACAACAACCAGCAGCAGATGGGCCTGGCAGCTTCCGCGCAGTTCCAGATGCCCCTTGCC
AGG
CCTCTGCCTTCAGCCACCATCTTTGGCCAGGCCAGTGTTGGTCCTGCCCTTACTCCTGGTGCTGCCA
TG
GCTCCTGGAGCTGCCCTTGCTCCTGCGGCAGCCCTCACTCCTGCGGCAGCCCTTGCTCCTGGGGCGGC
C
ATGGCTCTTGGAGCTGCCATGGCTACTGGGGCTGCCATGGCTACTGGAGCTGCCCTCACTCCTGGGGCA
GCC
CTCGCTCTTGGAGCTGCCATGGCTGCTGGGGCGGCCCTTGCTCCTGGAGCTGCCATGGCTCCTGGGG
CT
GCCATGGCTACTGGAGCGGCCCTCGCTTTTGGGGCTGCCATGGCTACTGGGACTACCCTCACTCCTGG
G
GCTGCCATGGCTCTTGGTGCTGCCATGGCTACTGGAGCTGCCCTCGCTCCTGGGGCAGCAGTGGCTCCT
AGG
GCGGCCCTTGCTCCTAGGGCTGCATTTGCTCCTGGGGCGGCGGCCCTCGCTCCTAGGGCTGCCCTCC
CT
CCTGGAGCGGCCCTCACTCCTGGGGCTGCACTTGCTCCTGGGGCGGCCCTCGCTCCTAGGGCTGCCCT
C
CCTCCTGGGGCTACCCTCCGTCCTGGGGCGGCCCTCATTCCTAGGGCGGCCCTTGCTCCTGGGGCTGCC
CTC
GCCCCTGGAGCGGCCCTCACTCCTGGGGCTGCACTTGCTCCTGGGGCGACCCTTGCTCCTAGGGCAG
CT
CTCGCTCCTGGGGCTGCCCTTGCTCCCAGAATTACCATCACTTCCAGGGCTGCCATCACTCCGGGAGT
T
GCTATTGCTCCAGGAGTTGCCACAGCCTCTACCGGCATATTGGCTCCAGGTGCTGCAACTGCCACTGTG
GGC
AATACATCCTCGACTACTATCACTGCTGCCACCGCTGCAGAGGGTGCCGCACCACACTTCACCTTCC
AA
CTGCCAGATGTCGAGTCGGAGTCTGAGTCTGAGTCGCTAGAGTTCGACGTGGTCACCAGCACCCTGGA
T
TCCCTGTTGGTCAGTGATGACGAAGATGAAGACGACTTTCTGAGGCGTTCCTCGAGCTCCAGCAGCCTC
AAT
GAATCCGAATTCGACAACACCAACTCCAGCCGCCGTCTGCCCATCTTCAGCCGCTTCTCAGACTCTG
AA
AAATGA


Translation (725 aa):
MANNNLNRPLNTNVADSSNSSSTPGTAPPPSSSDPQVLGHQAPSSSASSLTEDCSSSFARDLNSYNNGQS
G
ATGAVSWEAPHEPSEANAVSQIHPRNGEHSLQQKPKPQKVSGSSSLATSERYKTELCRPFEESGICKYG
H
KCQFAHGYRELRTLSRHPKYKTEPCRTFHSVGFCPYGTRCHFIHNQPEQQPVLSESTLEEPSSFNGSNV
L
HLGVNGEQQPGLQSDSPSGFLSVNSQALQAPLQLNQQALSSGGVMPSSHPAAANLRMMCCRTSSSTTAH
D
ADKDPDKDADKDPSNNSANDALAFPQEPGDFSPVAFQNPNTATTTPTAFYNNQQQMGLAASAQFQMPLA
R
PLPSATIFGQASVGPALTPGAAMAPGAALAPAAALTPAAALAPGAAMALGAAMATGAAMATGAALTPGA
A
LALGAAMAAGAALAPGAAMAPGAAMATGAALAFGAAMATGTTLTPGAAMALGAAMATGAALAPGAAVAP
R
AALAPRAAFAPGAAALAPRAALPPGAALTPGAALAPGAALAPRAALPPGATLRPGAALIPRAALAPGAA
L
APGAALTPGAALAPGATLAPRAALAPGAALAPRITITSRAAITPGVAIAPGVATASTGILAPGAATATV
G
NTSSTTITAATAAEGAAPHFTFQLPDVESESESESLEFDVVTSTLDSLLVSDDEDEDDFLRRSSSSSSL
N
ESEFDNTNSSRRLPIFSRFSDSEK




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser