NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS29840.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
29840.1 Public Mus musculus 19 Cpn1 21 106 86 CCDS HistoryNCBI Gene:93721Re-query CCDS DB by CCDS ID:29840.1Re-query CCDS DB by GeneID:93721See the combined annotation on chromosome 19 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 29840.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000026210 ENSMUSP00000026210 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000026210Link to Ensembl Protein Viewer:ENSMUSP00000026210Re-query CCDS DB by Nucleotide ID:ENSMUST00000026210Re-query CCDS DB by Protein ID:ENSMUSP00000026210
Original member Current member EBI,WTSI OTTMUST00000065251 OTTMUSP00000032496 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000065251Link to Vega Protein Viewer:OTTMUSP00000032496Re-query CCDS DB by Nucleotide ID:OTTMUST00000065251Re-query CCDS DB by Protein ID:OTTMUSP00000032496
Original member Current member NCBI NM_030703.2 NP_109628.1 Accepted alive Link to Nucleotide Sequence:NM_030703.2Link to Protein Sequence:NP_109628.1Re-query CCDS DB by Nucleotide ID:NM_030703Re-query CCDS DB by Protein ID:NP_109628Link to BLAST:NP_109628.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_109628.1 457 Q9JJN5 457 100% 0 0

Chromosomal Locations for CCDS 29840.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 19 (NC_000085.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19See the combined annotation on chromosome 19 in Sequence Viewer

Chromosome Start Stop Links
19 43956493 43956636 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 43959986 43960104 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 43963731 43963830 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 43966175 43966314 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 43968453 43968564 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 43970002 43970184 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 43973933 43974088 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 43980803 43980999 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 43986066 43986288 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1374 nt):
ATGCCAGACCTGCCCTCAGCCTTCCTGCCCCTCCTCCTCCTCTCCAAGTTTGTTACCCCGGTGACCTTTC
GT
CACCACCGCTACGACGACCTCGTGCGGACGCTGTACAAGGTGCACAACCAATGCCCGGACATCACGCG
G
CTCTACAACATCGGGCGCAGTGTGAAGGGGAGGTACCTCTACGTGCTGGAGTTTAGCGACTACCCTGGG
ATC
CATGAACCCTTGGAACCGGAAGTCAAGTATGTGGGAAACATGCACGGGAACGAAGTGCTGGGCCGCG
AG
CTGCTTCTGCAGCTGTCGGAATTCCTCTGCGAGGAGTTCCGGAACCGAAACCAGCGTATCCTGCGCCT
C
ATTCAGGACACGCGCATTCACATCCTGCCTTCCATGAACCCTGACGGCTACGAGGTGGCTGCTGCCCAG
GGC
CCAAACATGTCTGGGTATCTGGTTGGTAGGAACAATGCAAATGGGGTGGACCTGAACCGCAACTTCC
CG
GATCTCAACACCTACTTCTACTACAACTCCAAGAACGGTGGCCCTAACCACCACCTGCCCCTCCCCGA
C
AACTGGAAAAGTCAGGTGGAACCAGAGACCCGGGCGGTGATCCAGTGGATTCGCTCCTTGAACTTCGTT
CTC
TCAGCCAATATGCACGGCGGGGCTGTGGTGGCCAATTACCCATATGACAAGTCACTTGAGCATAGGT
TT
CGAGGTCCCCATCGCACCTCCAATTCCCCGACACCTGATGACGAGCTCTTCCAGACGCTGGCCAAGGT
C
TACTCCTACGCCCATGGATGGATGCACCAAGGTTGGAACTGTGGGGACTACTTTCCAGACGGCATCACC
AAC
GGGGCGTCCTGGTATTCTCTCAGCAAGGGAATGCAAGACTTCAATTATCTCCACACTAACTGCTTTG
AG
ATCACGCTCGAGCTGAGTTGCGACAAGTTTCCCCGGCAAGAGGAGCTGCAGAGGGAGTGGCTGGGTAA
C
CGGGAAGCCTTAATCCAGTTCTTGGAACAGGTCCACCAGGGCATCAAGGGAATGGTGTTGGATGAGAAC
TCT
AACAACCTCACGGGGGCTGTCATTTCCGTCACCGGCATCAACCACGACGTCACTTCAGGTGAACATG
GG
GATTATTTCCGGCTGCTGCTCCCGGGTACTTACTCTGTCACTGCCAAGGCACCAGGGTACGACCCCAA
A
ACAGTGACTGTGACGGTGGGACCTGCGGGACCAACAGTGGTTGACTTCCAACTCAAGCGAAGCTCATCT
CAG
GTGTACCCTGTGCAGAGAGCTCCCGGCCGAGGGCAGGGAGGCAGGGCAAAGCAGCCCCGGACATCCA
GA
AAGAAAGACCCAGCAACGAAACGGCATAGGGGTCCTGCATGA


Translation (457 aa):
MPDLPSAFLPLLLLSKFVTPVTFRHHRYDDLVRTLYKVHNQCPDITRLYNIGRSVKGRYLYVLEFSDYPG
I
HEP
LEPEVKYVGNMHGNEVLGRELLLQLSEFLCEEFRNRNQRILRLIQDTRIHILPSMNPDGYEVAAAQ
G
PNMSGYLVGRNNANGVDLNRNFPDLNTYFYYNSKNGGPNHHLPLPDNWKSQ
VEPETRAVIQWIRSLNFV
L
SANMHGGAVVANYPYDKSLEHRFRGPHRTSNSPTPDDELFQT
LAKVYSYAHGWMHQGWNCGDYFPDGIT
N
GASWYSLSK
GMQDFNYLHTNCFEITLELSCDKFPRQEELQREWLGNREALIQFLEQVHQGIKGMVLDEN
S
NNLTGAVISVTGINHDVTS
GEHGDYFRLLLPGTYSVTAKAPGYDPKTVTVTVGPAGPTVVDFQLKRSSS
Q
VYPVQRAPGRGQGGRAKQPRTSRKKDPATKRHRGPA




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser