NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS29817.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
29817.1 Public Mus musculus 19 Zdhhc16 23 108 98 CCDS HistoryNCBI Gene:74168Re-query CCDS DB by CCDS ID:29817.1Re-query CCDS DB by GeneID:74168See the combined annotation on chromosome 19 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 29817.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000026154.8 ENSMUSP00000026154.7 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000026154.8Link to Ensembl Protein Viewer:ENSMUSP00000026154.7Re-query CCDS DB by Nucleotide ID:ENSMUST00000026154Re-query CCDS DB by Protein ID:ENSMUSP00000026154
Original member Current member NCBI NM_023740.3 NP_076229.2 Accepted alive Link to Nucleotide Sequence:NM_023740.3Link to Protein Sequence:NP_076229.2Re-query CCDS DB by Nucleotide ID:NM_023740Re-query CCDS DB by Protein ID:NP_076229Link to BLAST:NP_076229.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_076229.2 361 Q9ESG8 361 100% 0 0

Chromosomal Locations for CCDS 29817.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 19 (NC_000085.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19See the combined annotation on chromosome 19 in Sequence Viewer

Chromosome Start Stop Links
19 41937608 41937850 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 41938023 41938217 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 41938364 41938452 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 41938808 41938836 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 41939600 41939733 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 41940650 41940735 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 41941516 41941639 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 41941936 41942006 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 41943582 41943696 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1086 nt):
ATGCGAGGCCAGCGAAGTCTGCTGTTGGGGCCAGCCCGCCTCTGCCTGCGCCTCCTTTTGCTCCTGGGCT
AC
CGGCGTCGATGCCCACCTCTGCTCCGGGGCCTGGTACAGCGCTGGCGTTATGGCAAGGTTTGCCTGCG
C
TCCCTGCTCTACAATTCCTTTGGAGGCAGTGACACTGCCGTTGATGCTGCCTTTGAGCCTGTCTACTGG
CTG
GTGGACAATGTGATCCGCTGGTTTGGAGTGGTGTTTGTGGTGCTGGTGATCGTGCTGACCGGGTCCA
TC
GTGGCCATTGCTTATCTGTGTGTCCTGCCCCTCATCCTCCGAACCTACTCGGTACCACGGCTCTGCTG
G
CATTTCTTCTATAGTCACTGGAATCTGATCCTCATCGTCTTCCATTACTACCAGGCCATCACCACTCCT
CCT
GGATACCCACCCCAGGGCAGGAATGACATTGCTACTGTCTCCATCTGTAAGAAGTGCATTTATCCCA
AG
CCAGCCCGAACACACCACTGCAGCATCTGTAATAGGTGTGTGCTGAAGATGGATCATCACTGCCCCTG
G
CTAAACAACTGTGTGGGCCACTATAACCATCGCTACTTCTTCTCTTTCTGCTTTTTCATGACTCTGGGC
TGT
GTCTACTGTAGCTATGGAAGTTGGGACCTTTTCCGGGAGGCTTATGCTGCCATTGAGACGTACCACC
AG
ACTCCACCACCTACCTTCTCCTTTCGAGAAAGGATAACTCACAAGAGTCTTGTCTACCTCTGGTTCCT
G
TGCAGTTCTGTGGCCCTGGCCCTGGGTGCCCTAACCATGTGGCATGCTGTTCTCATCAGTCGGGGTGAG
ACT
AGCATCGAAAGGCATATCAACAAGAAGGAGAGGCGCCGGTTACAGGCCAAGGGCAGGGTGTTTAGGA
AT
CCTTACAACTATGGCTGCTTGGACAACTGGAAGGTGTTCCTAGGTGTGGACACAGGAAGGCATTGGCT
G
ACCCGGGTGCTGTTACCTTCTAGTCACCTGCCCCATGGGAATGGGATGAGCTGGGACCCTCCTCCCTGG
GTG
ACTGCTCACTCAGCCTCTGTGATGGCCGTGTAA


Translation (361 aa):
MRGQRSLLLGPARLCLRLLLLLGYRRRCPPLLRGLVQRWRYGKVCLRSLLYNSFGGSDTAVDAAFEPVYW
L
VDNVIRWFGV
VFVVLVIVLTGSIVAIAYLCVLPLILRTYSVPRLCWHFFYSHWNLILIVFHYYQAITTP
P
GYPPQ
GRNDIATVSICKKCIYPKPARTHHCSICNRCVLKMDHHCPWLNNCVGHYNHRYFFSFCFFMTLG
C
VYCSYGSWDLFREAYAAIE
TYHQTPPPTFSFRERITHKSLVYLWFLCSSVALALGALTMWHAVLISRGE
T
SIERHINKKERRRLQAKGR
VFRNPYNYGCLDNWKVFLGVDTGRHWLTRVLLPSSHLPHGNGMSWDPPPW
V
TAHSASVMAV




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser