NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS29803.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
29803.1 Public Mus musculus 19 Aldh18a1 23 108 98 CCDS HistoryNCBI Gene:56454Re-query CCDS DB by CCDS ID:29803.1Re-query CCDS DB by GeneID:56454See the combined annotation on chromosome 19 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 29803.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000025979.12 ENSMUSP00000025979.6 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000025979.12Link to Ensembl Protein Viewer:ENSMUSP00000025979.6Re-query CCDS DB by Nucleotide ID:ENSMUST00000025979Re-query CCDS DB by Protein ID:ENSMUSP00000025979
Original member Current member NCBI NM_019698.2 NP_062672.2 Accepted alive Link to Nucleotide Sequence:NM_019698.2Link to Protein Sequence:NP_062672.2Re-query CCDS DB by Nucleotide ID:NM_019698Re-query CCDS DB by Protein ID:NP_062672Link to BLAST:NP_062672.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_062672.2 795 Q9Z110-1 795 100% 0 0

Chromosomal Locations for CCDS 29803.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 19 (NC_000085.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19See the combined annotation on chromosome 19 in Sequence Viewer

Chromosome Start Stop Links
19 40551148 40551329 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 40553524 40553619 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 40554591 40554777 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 40557419 40557540 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 40557651 40557846 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 40562902 40563039 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 40564836 40565056 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 40566572 40566665 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 40568322 40568395 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 40569033 40569177 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 40570468 40570592 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 40573771 40573861 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 40574211 40574369 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 40577578 40577682 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 40577772 40577921 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 40579862 40580076 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 40585490 40585577 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2388 nt):
ATGCTGAGACACATGCACCGCTCTGGGGTCCAGCCCTTCAGGCAACGTCTTCTACCATGGGTCCAGTCCA
TA
GCTGTGCCCAGATCAAATCGTGTCCAGCCCTCAGCTATTAGACATGTTCGTTCTTGGAGCAACATCCC
C
TTTATCACGGTACCCCTCAGTCGTGCCCACGGCAAGCCCTTTGCCCACCGAAGTGAGCTGAAGCACGCC
AAG
AGAATTGTAGTGAAACTCGGCAGTGCCGTGGTGACCAGAGGAGATGAGTGTGGCCTGGCACTGGGAC
GC
CTGGCATCTATTGTTGAACAGGTCTCGGTGCTGCAGAATCAGGGCCGAGAGATGATGCTGGTGACCAG
T
GGAGCCGTCGCCTTCGGCAAACAGCGCCTGCGCCATGAGATCCTTCTGTCTCAGAGCGTGCGGCAAGCC
CTG
CACTCAGGACAGAACCATCTGAAGGAGATGGCAATTCCGGTCTTAGAGGCCCGAGCCTGTGCAGCTG
CT
GGACAGAGTGGACTGATGGCCTTGTACGAGGCCATGTTTACACAGTACAGCATCTGTGCTGCCCAGAT
C
TTGGTGACCAACCTGGATTTCCACGACGAGCAGAAGCGCAGAAATCTCAACGGTACCCTCCACGAGCTG
CTC
CGCATGAACATCGTCCCCATCGTCAACACAAACGATGCCGTCGTCCCTCCAGCCGAGCCCAACAGTG
AT
CTTCAGGGGGTAAATGTGATTAGTGTTAAGGATAATGATAGCCTGGCTGCCCGGCTGGCCGTGGAGAT
G
AAAACCGACCTCTTGATTGTCCTCTCGGACGTAGAAGGCCTCTTTGACAGCCCCCCAGGCTCAGATGAT
GCA
AAGCTCATTGATATATTCTATCCGGGAGATCAGCAGTCTGTGACATTTGGAACCAAGTCTAGAGTGG
GC
CTAGGGGGCATGGAAGCCAAGGTGAAAGCCGCCCTCTGGGCTTTGCAAGGCGGGACTTCTGTCGTCAT
T
GCCAACGGGACCCACCCAAAGGTGTCTGGGCACGTCATCACAGACATCGTGGAGGGAAAGAAAGTTGGC
ACC
TTCTTTTCAGAAGTGAAGCCTGCTGGTCCTACAGTGGAGCAGCAGGGGGAGATGGCTCGATCTGGTG
GG
AGAATGCTGGCTACCTTAGAGCCTGAACAGAGAGCTGAAATTATCAATCATCTGGCTGACCTGCTGAC
G
GACCAGCGGGAAGAGATCCTGTTAGCCAACAAAAAAGATTTGGAGGAGGCAGAGGGAAGACTTGCCAGC
CCC
CTGCTGAAGCGCCTTAGCCTCTCCACGTCCAAACTGAACAGCCTGGCCATCGGGCTGCGGCAGATCG
CA
GCCTCCTCACAAGAGAGCGTAGGCCGCGTCCTGCGCCGGACTCGGATTGCCAAAAACCTGGAGTTAGA
A
CAAGTGACTGTCCCAATAGGTGTTTTACTGGTGATCTTTGAGTCTCGCCCTGACTGTCTACCCCAGGTG
GCA
GCCTTGGCTATTGCCAGTGGCAATGGCTTGTTGCTCAAAGGTGGGAAGGAGGCCGCACACAGCAACC
GC
ATTCTTCACCTCCTGACCCAGGAGGCCCTCTCCATCCACGGAGTCAAGGAGGCCATACAGCTGGTAAA
C
ACCAGAGAAGAAGTTGAGGATCTCTGCCGCCTTGACAAAATAATAGATCTGATCATTCCCCGAGGCTCC
TCC
CAGCTGGTCAGAGACATCCAGAAAGCTGCCAAAGGGATCCCAGTGATGGGCCACAGCGAAGGCATCT
GC
CACATGTACGTGGATTCCGAAGCCAGCGTGGACAAGGTCACCCGACTCGTCAGAGACTCTAAATGTGA
A
TACCCAGCCGCCTGTAATGCCCTGGAGACGTTGCTTATCCACCGAGATCTGCTGAGAACACCCTTATTT
GAC
CAGATCATTGACATGCTCCGAGTGGAACAGGTAAAAATTCACGCAGGCCCCAAGTTTGCCTCCTACC
TG
ACCTTCAGCCCCTCAGAAGTGAAGTCACTCCGGACGGAGTACGGGGACCTGGAAGTGTGCATTGAAGT
G
GTGGACAGCGTCCAGGAAGCCATTGATCACATCCATAAGTACGGCAGCTCTCACACAGATGTCATCGTC
ACA
GAGAACGAGAAAACAGCGGAGTTCTTCCTCCAGCACGTGGACAGCGCCTGTGTCTTCTGGAACGCCA
GT
ACTCGCTTCTCTGATGGTTACCGCTTTGGACTGGGAGCTGAAGTTGGAATCAGCACATCTCGAATCCA
C
GCCCGGGGACCAGTAGGACTTGAGGGATTGCTAACTACAAAGTGGTTGCTTCGAGGGCAAGACCACGTG
GTC
TCGGACTTCTCCGAGCATGGAAGCCTCAAGTATCTTCACGAGAATCTCCCTGTTCCCCAGAGAAATT
TC
AGCTGA


Translation (795 aa):
MLRHMHRSGVQPFRQRLLPWVQSIAVPRSNRVQPSAIRHVRSWSNIPFITVPLSRAHGKPFAHRSELKHA
K
RIVVKLGSAVVTRGDECGLALGRLASIVEQ
VSVLQNQGREMMLVTSGAVAFGKQRLRHEILLSQSVRQA
L
HSGQNHLKEM
AIPVLEARACAAAGQSGLMALYEAMFTQYSICAAQILVTNLDFHDEQKRRNLNGTLHEL
L
RMNIVPIVNTNDAVVPPAEPNSDLQGVN
VISVKDNDSLAARLAVEMKTDLLIVLSDVEGLFDSPPGSDD
A
KLIDIFYPGDQQSVTFGTKSRVGLGGMEAK
VKAALWALQGGTSVVIANGTHPKVSGHVITDIVEGKKVG
T
FFSEVKPA
GPTVEQQGEMARSGGRMLATLEPEQRAEIINHLADLLTDQREEILLANKKDLEEAEGRLAS
P
LLKRLSLSTSKLNSLAIGLRQIAASSQESVGRVLRRTRIAKNLELEQVTVPIGVLLVIFESRPDCLPQ
V
A
ALAIASGNGLLLKGGKEAAHSNRILHLLTQEALSIHGVKEAIQL
VNTREEVEDLCRLDKIIDLIIPRGS
S
QLVRDIQKAAKGIPVMGHSEGICHMYVDSEASVDKVTRL
VRDSKCEYPAACNALETLLIHRDLLRTPLF
D
QIIDMLRVEQ
VKIHAGPKFASYLTFSPSEVKSLRTEYGDLEVCIEVVDSVQEAIDHIHKYGSSHTDVIV
T
EN
EKTAEFFLQHVDSACVFWNASTRFSDGYRFGLGAEVGISTSRIHARGPVGLEGLLTTKWLLRGQDHV
V
SDFSEHGSLKYLHENLPVPQRNFS




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser