NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS29505.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
29505.1 Public Mus musculus 19 Slc22a12 21 106 86 CCDS HistoryNCBI Gene:20521Re-query CCDS DB by CCDS ID:29505.1Re-query CCDS DB by GeneID:20521See the combined annotation on chromosome 19 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 29505.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000113451 ENSMUSP00000109078 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000113451Link to Ensembl Protein Viewer:ENSMUSP00000109078Re-query CCDS DB by Nucleotide ID:ENSMUST00000113451Re-query CCDS DB by Protein ID:ENSMUSP00000109078
Original member Current member EBI,WTSI OTTMUST00000044832 OTTMUSP00000020168 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000044832Link to Vega Protein Viewer:OTTMUSP00000020168Re-query CCDS DB by Nucleotide ID:OTTMUST00000044832Re-query CCDS DB by Protein ID:OTTMUSP00000020168
Original member Current member NCBI NM_009203.3 NP_033229.3 Accepted alive Link to Nucleotide Sequence:NM_009203.3Link to Protein Sequence:NP_033229.3Re-query CCDS DB by Nucleotide ID:NM_009203Re-query CCDS DB by Protein ID:NP_033229Link to BLink:NP_033229.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_033229.3 553 Q8CFZ5 553 99.8192% 0 1

Chromosomal Locations for CCDS 29505.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 19 (NC_000085.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 19Link to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19See the combined annotation on chromosome 19 in Sequence Viewer

Chromosome Start Stop Links
19 6536129 6536192 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 6536737 6536940 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 6537117 6537225 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 6537638 6537852 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 6538417 6538532 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 6538676 6538799 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 6540329 6540497 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 6540575 6540729 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 6541060 6541163 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 6542351 6542752 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1662 nt):
ATGGCCTTTCCTGAACTCCTGGACCGAGTGGGGGGGCTGGGCAGGTTCCAGCTCTTCCAGACGGTGGCTC
TG
GTGACCCCCATTTTGTGGGTCACCACCCAGAACATGCTGGAGAACTTCTCAGCCGCAGTTCCCCACCA
C
CGCTGTTGGGTGCCTCTCCTGGACAATAGCACCTCCCAGGCGAGTATCCCTGGGGACCTTGGACCCGAT
GTT
CTTCTGGCCGTCTCCATCCCACCTGGTCCTGACCAGCAACCCCACCAGTGCCTCCGCTTCCGACAAC
CT
CAATGGCAGCTTACAGAGTCCAACGCCACGGCCACCAACTGGAGTGACGCTGCCACTGAGCCATGCGA
G
GATGGCTGGGTTTACGACCACAGCACCTTCAGGTCCACAATCGTGACCACGTGGGACCTGGTATGTAAC
TCC
CAGGCCCTGAGACCCATGGCCCAGTCCATCTTCCTGGCTGGAATCCTGGTAGGAGCCGCAGTGTGTG
GC
CATGCCTCAGATAGGTTTGGGCGCAGAAGGGTGCTGACCTGGAGCTATCTTCTGGTGTCCGTGTCCGG
C
ACAGCAGCTGCCTTCATGCCCACCTTCCCCCTCTACTGCCTGTTTCGTTTCCTGCTGGCCTCTGCAGTG
GCA
GGTGTCATGATGAACACAGCCAGTCTCTTGATGGAGTGGACATCAGCCCAGGGTAGCCCTTTGGTGA
TG
ACCTTGAACGCCTTGGGCTTCAGCTTTGGGCAGGTCCTGACAGGTTCTGTGGCCTATGGTGTGCGCAG
C
TGGAGGATGCTACAGCTGGCTGTCTCTGCCCCCTTCTTCCTCTTCTTTGTTTATTCATGGTGGCTACCA
GAA
TCGGCACGCTGGCTCATCACGGTAGGCAAGCTGGACCAGGGCCTGCAGGAACTACAGAGGGTAGCTG
CT
GTCAACAGGAGGAAGGCAGAGGGAGACACGTTGACCATGGAGGTGCTGCGGTCAGCTATGGAGGAGGA
A
CCAAGCAGGGACAAAGCTGGTGCCAGTCTGGGCACTCTACTCCACACACCTGGGCTGCGCCACCGAACC
ATC
ATCTCCATGCTGTGCTGGTTTGCCTTTGGCTTCACCTTCTACGGCCTGGCCCTTGACCTGCAAGCCC
TA
GGAAGCAATATCTTCCTGCTCCAGGCACTCATCGGGATTGTGGACTTCCCGGTGAAGACAGGCAGCCT
G
CTGCTGATCAGCCGCTTGGGCCGGCGCCTCTGCCAGGTCAGCTTCCTGGTGCTCCCCGGACTCTGCATC
CTG
TCCAACATACTGGTGCCCCATGGGATGGGGGTCCTTCGCTCGGCCCTGGCTGTGCTGGGGCTGGGCT
GC
CTGGGGGGCGCCTTCACCTGCATCACCATCTTCTCCAGTGAGCTCTTCCCCACTGTGATCAGGATGAC
T
GCAGTGGGCCTCTGCCAGGTGGCAGCCCGAGGGGGAGCCATGCTAGGGCCTTTGGTACGGCTGCTGGGT
GTC
TATGGCTCCTGGATGCCCCTGCTGGTGTATGGAGTGGTGCCAGTGTTAAGTGGCCTAGCTGCACTGC
TG
CTGCCTGAGACCAAGAACTTACCACTGCCTGACACCATCCAAGACATCCAGAAACAGTCAGTGAAGAA
G
GTAACACATGACACACCAGATGGCTCCATCCTGATGTCTACCCGGCTGTAG


Translation (553 aa):
MAFPELLDRVGGLGRFQLFQTVALVTPILWVTTQNMLENFSAAVPHHRCWVPLLDNSTSQASIPGDLGPD
V
LLAVSIPPGPDQQPHQCLRFRQPQWQLTESNATATNWSDAATEPCEDGWVYDHSTFRSTIVTT
WDLVCN
S
QALRPMAQSIFLAGILVGAAVCGHASD
RFGRRRVLTWSYLLVSVSGTAAAFMPTFPLYCLFRFLLASAV
A
GVMMNTASL
LMEWTSAQGSPLVMTLNALGFSFGQVLTGSVAYGVRSWRMLQLAVSAPFFLFFVYSWWLP
E
SARWLITVGKLDQGLQELQRVAAVNRRKAEGDTLTME
VLRSAMEEEPSRDKAGASLGTLLHTPGLRHRT
I
ISMLC
WFAFGFTFYGLALDLQALGSNIFLLQALIGIVDFPVKTGSLLLISRLGRRLCQVSFLVLPGLCI
L
SNILVPH
GMGVLRSALAVLGLGCLGGAFTCITIFSSELFPTVIRMTAVGLCQVAARGGAMLGPLVRLLG
V
YGSWMPLLVYGVVPVLSGLAALLLPETKNLPLPDTIQDIQK
QSVKKVTHDTPDGSILMSTRL



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser