NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS29431.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
29431.1 Public Mus musculus 19 Lrfn4 21 106 86 CCDS HistoryNCBI Gene:225875Re-query CCDS DB by CCDS ID:29431.1Re-query CCDS DB by GeneID:225875See the combined annotation on chromosome 19 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 29431.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000053597 ENSMUSP00000050039 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000053597Link to Ensembl Protein Viewer:ENSMUSP00000050039Re-query CCDS DB by Nucleotide ID:ENSMUST00000053597Re-query CCDS DB by Protein ID:ENSMUSP00000050039
Original member Current member EBI,WTSI ENSMUST00000113822 ENSMUSP00000109453 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000113822Link to Ensembl Protein Viewer:ENSMUSP00000109453Re-query CCDS DB by Nucleotide ID:ENSMUST00000113822Re-query CCDS DB by Protein ID:ENSMUSP00000109453
Original member Current member EBI,WTSI OTTMUST00000035411 OTTMUSP00000015831 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000035411Link to Vega Protein Viewer:OTTMUSP00000015831Re-query CCDS DB by Nucleotide ID:OTTMUST00000035411Re-query CCDS DB by Protein ID:OTTMUSP00000015831
Original member Current member EBI,WTSI OTTMUST00000035412 OTTMUSP00000015832 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000035412Link to Vega Protein Viewer:OTTMUSP00000015832Re-query CCDS DB by Nucleotide ID:OTTMUST00000035412Re-query CCDS DB by Protein ID:OTTMUSP00000015832
Original member Current member NCBI NM_153388.4 NP_700437.2 Accepted alive Link to Nucleotide Sequence:NM_153388.4Link to Protein Sequence:NP_700437.2Re-query CCDS DB by Nucleotide ID:NM_153388Re-query CCDS DB by Protein ID:NP_700437Link to BLAST:NP_700437.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_700437.2 636 Q80XU8 636 100% 0 0

Chromosomal Locations for CCDS 29431.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 19 (NC_000085.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19See the combined annotation on chromosome 19 in Sequence Viewer

Chromosome Start Stop Links
19 4612077 4612638 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 4613156 4614504 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1911 nt):
ATGGCCCCGCCGCTCCTATTGCTGCTGCTGGCCAGTGGAGCCGCTGCTTGCCCGCTACCCTGTGTGTGCC
AG
AACCTGTCGGAGTCACTCAGCACCCTTTGTGCCCACCGAGGCCTGCTGTTTGTGCCACCCAACGTGGA
C
AGGCGCACAGTTGAACTGCGCCTGGCCGACAACTTCATCCAGGCCCTGGGACCACCTGACTTCCGCAAC
ATG
ACAGGGCTGGTGGACCTAACATTGTCTCGAAATGCCATCACCCGCATTGGGGCTCGCTCCTTTGGGG
AC
CTGGAGAGCCTGCGCTCCTTGCACCTGGATGGCAACAGGCTGGTGGAGCTGGGCAGCAGCAGCCTACG
G
GGGCCTGTCAACCTCCAGCATCTCATTCTCAGTGGCAATCAACTGGGCCGCATCGCCCCCGGGGCCTTC
GAC
GACTTCCTTGACAGTCTCGAGGACCTGGATGTGTCCTATAACAACCTCCGGCAGGTTCCCTGGGCTG
GC
ATAGGCTCCATGCCTGCCCTGCATACCCTGAACCTGGACCATAACCTCATCGATGCACTACCCCCAGG
T
GTCTTTGCTCAGCTCAGCCAGCTCTCCCGCCTTGACCTCACCTCCAACCGCCTGGCCACCCTGGCACCT
GAT
CCACTCTTCTCCCGAGGCCGGGATGCTGAGGCCTCACCTTCTCCCCTGGTGCTGAGTTTCAGCGGGA
AC
CCACTGCACTGCAACTGTGAGCTGCTGTGGCTGCGGCGGCTGGCCCGGCCCGATGACCTGGAAACCTG
C
GCTTCTCCACCAACCCTGGCAGGCCGCTACTTCTGGGCAGTGCCTGAGGGAGAGTTCTCCTGTGAGCCT
CCG
CTGATTGCCCGGCACACACAGCGCCTGTGGGTGCTAGAGGGCCAGCGGGCCACCCTACGGTGCAGGG
CC
CTTGGTGACCCTGTACCTACCATGCACTGGGTTGGCCCTGATGACAGGCTGGTTGGCAACTCTTCTCG
A
GCCTGGGCTTTCCCCAATGGGACCCTAGAGATTGGGGTGACGGGCGCTGGAGATGCAGGAGCCTATACC
TGC
ATTGCCACCAACCCTGCTGGTGAGGCCACAGCCCGAGTGGAGCTCCGGGTACTGGCCTTGCCCCATG
GT
GGGAACACCAGTGCTGAGGGGGGCCGTCCTGGGCCTTCGGACATTGCTGCTTCTGCTAGAACTGCTGC
C
GAAGGCGAGGGAACTTTAGAATCTGAACCAGCAGTGCAAGTGACGGAGGTGACTGCCACCTCTGGCCTG
GTG
AGCTGGGGCCTGGGGCGGCCAGCTGACCCAGTGTGGATGTTCCAAATCCAGTACAACAGCAGCGAGG
AT
GAGACCCTCATCTACCGGATTGTACCAGCCTCCAGCCACCACTTCCTGCTGAAGCACCTGGTTCCCGG
T
GCTGACTACGACCTCTGCCTGCTGGCCCTGTCACCTGCTGCTGGGCCCTCCGACCTCACGGCCACTAGA
CTG
CTGGGCTGTGCCCACTTCTCTACGCTACCAGCCACCCCCCTGTGCCATGCCCTACAGGCCCATGTGC
TG
GGCGGGACCCTGACTGTGGCAGTGGGGGGCGTCCTAGTGGCTGCCTTACTGGTCTTCACTGTGGCCTT
G
CTGGTTCGGGGCCGGGGAGCTGGGAATGGCCGCCTCCCACTCAAACTCAGCCATGTCCAATCCCAGACC
AAT
GGTGGCACCAGCCCCATGCCCAAGAGCCACCCACCACGGAGCCCTCCACCCCGTCCTCAGCGCAGCT
GC
TCCCTGGACCTAGGAGACACCGGAGGATGCTACGGGTATGCCAGGCGCCTGGGAGGAGCCTGGGCCCG
G
CGGAGCCACTCTGTACATGGGGGGCTGCTGGGAGCTGGGTGTCGGGGGGTGGGGGGCAGTGCGGAGCGG
CTG
GAGGAGAGTGTGGTGTGA


Translation (636 aa):
MAPPLLLLLLASGAAACPLPCVCQNLSESLSTLCAHRGLLFVPPNVDRRTVELRLADNFIQALGPPDFRN
M
TGLVDLTLSRNAITRIGARSFGDLESLRSLHLDGNRLVELGSSSLRGPVNLQHLILSGNQLGRIAPGAF
D
DFLDSLEDLDVSYNNLRQVPWAGIGSMPALHTLNLDHNLIDALPPGVFAQLSQLSRLDLTSNRLATLAP
D
PLFSRGRDAEASPSPLVLSFSGNPLHCNCELLWLRRLARPDDLETCASPPTLAGRYFWAVPEGEFSCEP
P
LIARHTQRLWVLEGQRATLRCRALGDPVPTMHWVGPDDRLVGNSSRAWAFPNGTLEIGVTGAGDAGAYT
C
IATNPAGEATARVELRVLALPHGGNTSAEGGRPGPSDIAASARTAAEGEGTLESEPAVQVTEVTATSGL
V
SWGLGRPADPVWMFQIQYNSSEDETLIY
RIVPASSHHFLLKHLVPGADYDLCLLALSPAAGPSDLTATR
L
LGCAHFSTLPATPLCHALQAHVLGGTLTVAVGGVLVAALLVFTVALLVRGRGAGNGRLPLKLSHVQSQT
N
GGTSPMPKSHPPRSPPPRPQRSCSLDLGDTGGCYGYARRLGGAWARRSHSVHGGLLGAGCRGVGGSAER
L
EESVV




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser