NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS29358.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
29358.1 Public Mus musculus 18 Atp5a1 23 108 98 CCDS HistoryNCBI Gene:11946Re-query CCDS DB by CCDS ID:29358.1Re-query CCDS DB by GeneID:11946See the combined annotation on chromosome 18 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 29358.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000026495.14 ENSMUSP00000026495.8 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000026495.14Link to Ensembl Protein Viewer:ENSMUSP00000026495.8Re-query CCDS DB by Nucleotide ID:ENSMUST00000026495Re-query CCDS DB by Protein ID:ENSMUSP00000026495
Original member Current member NCBI NM_007505.2 NP_031531.1 Accepted alive Link to Nucleotide Sequence:NM_007505.2Link to Protein Sequence:NP_031531.1Re-query CCDS DB by Nucleotide ID:NM_007505Re-query CCDS DB by Protein ID:NP_031531Link to BLAST:NP_031531.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_031531.1 553 Q03265 553 100% 0 0

Chromosomal Locations for CCDS 29358.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 18 (NC_000084.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18See the combined annotation on chromosome 18 in Sequence Viewer

Chromosome Start Stop Links
18 77774051 77774110 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 77775777 77775855 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 77777519 77777688 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 77778462 77778635 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 77778732 77778898 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 77779079 77779227 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 77779827 77779978 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 77780079 77780303 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 77780985 77781092 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 77781212 77781356 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 77781799 77781949 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 77782301 77782382 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1662 nt):
ATGCTGTCTGTGCGCGTCGCCGCGGCCGTGGCCCGTGCCCTCCCTCGACGGGCGGGACTGGTCTCCAAAA
AT
GCTTTGGGGTCATCCTTTGTTGGTGCAAGAAATCTCCATGCCTCTAACACTCGACTTCAGAAGACTGG
C
ACAGCTGAGATGTCCTCCATTCTCGAGGAGAGGATTCTGGGAGCTGACACGTCTGTTGACCTGGAGGAG
ACT
GGGCGTGTGTTAAGCATTGGTGATGGTATTGCGCGAGTGCACGGGCTGAGGAATGTTCAAGCAGAGG
AG
ATGGTGGAATTCTCTTCAGGCTTAAAGGGTATGTCCCTGAACTTGGAACCCGACAATGTTGGAGTTGT
C
GTGTTTGGGAATGACAAGCTAATTAAAGAAGGAGACGTTGTGAAGAGGACAGGCGCCATCGTGGATGTC
CCC
GTTGGCGAGGAGCTGTTGGGCCGTGTGGTTGACGCCCTCGGTAATGCTATTGATGGAAAGGGTCCAA
TT
GGTTCCAAGACCCGCAGACGAGTGGGCCTGAAAGCCCCTGGAATTATCCCCCGAATCTCTGTGCGGGA
G
CCGATGCAGACCGGCATCAAGGCTGTGGATAGCCTGGTGCCCATTGGCCGGGGTCAGCGTGAGCTGATT
ATT
GGTGACAGACAGACTGGGAAAACATCGATTGCCATTGACACAATCATCAACCAGAAACGTTTCAACG
AT
GGGACCGACGAGAAGAAGAAGCTGTACTGCATCTACGTCGCGATTGGTCAGAAGCGGTCCACTGTGGC
T
CAGCTGGTGAAGAGACTGACGGATGCGGATGCCATGAAGTACACCATCGTGGTGTCAGCCACTGCCTCT
GAC
GCTGCCCCGCTTCAGTACTTGGCTCCCTACTCCGGCTGCTCCATGGGAGAGTACTTTAGAGACAACG
GC
AAGCACGCTTTGATCATCTATGACGATCTATCCAAGCAGGCTGTCGCTTACCGCCAGATGTCTCTGTT
G
CTCCGCCGACCCCCTGGTCGTGAGGCCTATCCTGGTGATGTGTTCTACCTACACTCCCGCCTGCTGGAG
AGA
GCAGCCAAGATGAACGATTCCTTTGGTGGTGGCTCTTTGACTGCCTTACCAGTCATTGAAACACAGG
CT
GGTGATGTGTCCGCTTACATTCCAACAAATGTTATTTCCATCACTGACGGACAGATCTTCTTGGAAAC
A
GAATTGTTCTATAAAGGCATCCGCCCTGCCATTAATGTGGGTTTGTCTGTGTCCCGTGTCGGATCTGCT
GCC
CAAACCAGAGCCATGAAGCAGGTGGCAGGTACCATGAAGCTGGAGTTGGCTCAGTACCGGGAGGTGG
CT
GCGTTTGCCCAGTTTGGTTCTGATTTGGACGCTGCCACTCAACAGCTCTTGAGTCGTGGTGTGCGTCT
G
ACCGAGTTGCTAAAGCAAGGACAGTACTCTCCCATGGCTATTGAAGAACAGGTGGCTGTTATCTATGCG
GGT
GTACGGGGTTATCTTGACAAACTGGAGCCCAGCAAGATCACAAAGTTTGAGAATGCTTTCTTGTCTC
AC
GTTATCAGCCAGCACCAGTCCCTCTTGGGCAATATCAGGTCTGATGGGAAAATCTCAGAACAGTCAGA
C
GCAAAGCTCAAAGAGATTGTAACAAACTTCTTGGCTGGGTTTGAACCATAA


Translation (553 aa):
MLSVRVAAAVARALPRRAGLVSKNALGSSFVGARNLHASNTRLQKTGTAEMSSILEERILGADTSVDLEE
T
GRVLSIGDGIARVHGLRNVQAEEMVEFSSGLK
GMSLNLEPDNVGVVVFGNDKLIKEGDVVKRTGAIVDV
P
VGEELLGRVVDALGNAIDGK
GPIGSKTRRRVGLKAPGIIPRISVREPMQTGIKAVDSLVPIGRGQRELI
I
GDRQT
GKTSIAIDTIINQKRFNDGTDEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATAS
D
AAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQ
AVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLE
R
AAKMNDSFGGGSLTALPVIETQAGDVSAYIPTNVISITDGQ
IFLETELFYKGIRPAINVGLSVSRVGSA
A
QTRAMKQ
VAGTMKLELAQYREVAAFAQFGSDLDAATQQLLSRGVRLTELLKQGQYSPMAIEEQVAVIYA
G
VRGYLDKLEPSKITKFENAFLSHVISQHQSLLGNI
RSDGKISEQSDAKLKEIVTNFLAGFEP



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser