NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS29258.2 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
29258.2 Public Mus musculus 18 Aldh7a1 23 108 98 CCDS HistoryNCBI Gene:110695Re-query CCDS DB by CCDS ID:29258.2Re-query CCDS DB by GeneID:110695See the combined annotation on chromosome 18 in Sequence Viewer

Public Note for CCDS 29258.1
The coding region has been updated to extend the N-terminus to one that is more supported by available conservation data.

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq, Havana and CCDS collaboration)

Sequence IDs included in CCDS 29258.2

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000066208.12 ENSMUSP00000065089.6 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000066208.12Link to Ensembl Protein Viewer:ENSMUSP00000065089.6Re-query CCDS DB by Nucleotide ID:ENSMUST00000066208Re-query CCDS DB by Protein ID:ENSMUSP00000065089
Original member Current member NCBI NM_138600.4 NP_613066.2 Accepted alive Link to Nucleotide Sequence:NM_138600.4Link to Protein Sequence:NP_613066.2Re-query CCDS DB by Nucleotide ID:NM_138600Re-query CCDS DB by Protein ID:NP_613066Link to BLAST:NP_613066.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_613066.2 539 Q9DBF1-1 539 100% 0 0

Chromosomal Locations for CCDS 29258.2

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 18 (NC_000084.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18See the combined annotation on chromosome 18 in Sequence Viewer

Chromosome Start Stop Links
18 56526953 56527007 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 56528277 56528352 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 56531490 56531563 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 56531711 56531808 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 56531981 56532097 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 56532488 56532594 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 56534190 56534274 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 56537204 56537298 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 56538701 56538742 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 56542225 56542322 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 56544965 56545042 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 56546904 56546948 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 56548447 56548579 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 56550296 56550419 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 56551160 56551240 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 56559222 56559287 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 56560776 56560829 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 56562033 56562224 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1620 nt):
ATGTGGCGTGTGCCCCGCAGGCTCTGTGTGCAGTCTGTGAAGACCAGCAAGCTTTCCGGACCTTGGAGCA
GG
CCCGCCGCCCACATGTCTACTCTGCTGATCCATCATCCCCAGTATGCCTGGCTGCAAGACCTGGGGCT
C
CGCGAGGATAACGAGGGCGTGTATAATGGAAGCTGGGGCGGCCGGGGAGAGGTAATTACGACCTATTGT
CCT
GCTAACAATGAGCCAATAGCAAGAGTCCGACAGGCCAGCCTGAAGGACTATGAAGAAACCATCGGGA
AA
GCCAAGAAAGCCTGGAACATCTGGGCAGATATTCCTGCCCCAAAACGCGGAGAAATAGTCAGAAAGAT
T
GGCGATGCCTTCCGGGAGAAGATCCAACTACTGGGAAGACTGGTGTCTTTGGAGATGGGGAAAATCCTG
GTG
GAAGGAATAGGCGAGGTTCAGGAGTACGTGGACGTCTGCGATTATGCTGCTGGCTTGTCGAGGATGA
TC
GGGGGACCCACCTTGCCTTCTGAAAGACCCGGCCATGCTCTCATCGAAATGTGGAATCCCTTAGGCTT
G
GTGGGAATCATCACTGCCTTCAATTTCCCCGTGGCTGTGTTTGGCTGGAACAATGCCATAGCTCTGATC
ACA
GGGAATGTCTGCCTTTGGAAAGGAGCACCGACTACGTCCCTCGTTAGTGTGGCTGTCACAAAGATCA
TA
GCCCAGGTTTTGGAGGACAACCTGCTGCCCGGTGCCATTTGTTCCCTGGTTTGTGGTGGAGCAGATAT
C
GGCACAACGATGGCCAGAGATGAGCGTGTGAACCTGCTGTCCTTCACTGGGAGCACTCAGGTGGGGAAG
GAG
GTGGCCCTCATGGTGCAGGAGAGGTTTGGGAAAAGCTTGTTGGAGCTTGGAGGAAACAATGCCATTA
TT
GCTTTCGAGGACGCGGACCTCAGCTTGGTTGTTCCGTCAGTTCTGTTTGCCGCCGTGGGAACAGCTGG
G
CAAAGGTGTACCACTGTGAGGAGACTGTTTTTGCACGAAAGCATCCATAATGAAGTTGTGGACAGACTG
AGA
AGTGCCTACTCACAGATCCGTGTTGGGAACCCCTGGGACCCCAATATCCTCTATGGACCGCTCCATA
CC
AAACAGGCAGTGAGCATGTTTGTGAGAGCCGTGGAAGAAGCCAAGAAACAAGGGGGCACAGTGGTCTA
T
GGGGGCAAGGTCATGGACCACCCTGGCAATTACGTGGAACCCACCATTGTGACCGGTCTTGCCCATGAT
GCG
CCCATTGTTCACCAGGAGACTTTTGCCCCAATCCTCTATGTCTTCAAATTCCAGGATGAAGAAGAGG
TC
TTTGAATGGAACAATGAAGTAAAACAGGGACTTTCAAGTAGTATCTTTACCAAAGATTTGGGCAGAAT
C
TTCCGCTGGCTTGGACCTAAAGGTTCCGACTGTGGCATCGTGAACGTCAATATTCCTACCAGCGGGGCT
GAG
ATTGGTGGTGCGTTTGGCGGAGAGAAGCACACTGGCGGTGGCCGGGAGTCTGGCAGCGACGCCTGGA
AG
CAGTACATGAGGAGATCCACATGTACCATCAACTACAGCACGTCCCTCCCTCTGGCTCAGGGAATCAA
G
TTTCAGTGA


Translation (539 aa):
MWRVPRRLCVQSVKTSKLSGPWSRPAAHMSTLLIHHPQYAWLQDLGLREDNEGVYNGSWGGRGEVITTYC
P
ANNEPIARVRQ
ASLKDYEETIGKAKKAWNIWADIPAPKRGEIVRKIGDAFREKIQLLGRLVSLEMGKIL
V
EGIGEVQEYVDVCDYAAGLSRMIGGPTLPSE
RPGHALIEMWNPLGLVGIITAFNFPVAVFGWNNAIALI
T
GNVCL
WKGAPTTSLVSVAVTKIIAQVLEDNLLPGAICSLVCGGADIGTTMARDERVNLLSFTGSTQVGK
E
VALMVQERF
GKSLLELGGNNAIIAFEDADLSLVVPSVLFAAVGTAGQRCTTVRRLFLHESIHNEVVDRL
R
SAYSQIRVGNPWD
PNILYGPLHTKQAVSMFVRAVEEAKKQGGTVVYGGKVMDHPGNYVEPTIVTGLAHD
A
PIVHQETFAPILYVFKFQ
DEEEVFEWNNEVKQGLSSSIFTKDLGRIFRWLGPKGSDCGIVNVNIPTSGA
E
IGGAF
GGEKHTGGGRESGSDAWKQYMRRSTCTINYSTSLPLAQGIKFQ



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser