NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS29058.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
29058.1 Public Mus musculus 18 Mib1 23 108 98 CCDS HistoryNCBI Gene:225164Re-query CCDS DB by CCDS ID:29058.1Re-query CCDS DB by GeneID:225164See the combined annotation on chromosome 18 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 29058.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000052838.10 ENSMUSP00000054428.4 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000052838.10Link to Ensembl Protein Viewer:ENSMUSP00000054428.4Re-query CCDS DB by Nucleotide ID:ENSMUST00000052838Re-query CCDS DB by Protein ID:ENSMUSP00000054428
Original member Current member EBI,WTSI ENSMUST00000165555.7 ENSMUSP00000131712.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000165555.7Link to Ensembl Protein Viewer:ENSMUSP00000131712.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000165555Re-query CCDS DB by Protein ID:ENSMUSP00000131712
Original member Current member NCBI NM_001364997.1 NP_001351926.1 Accepted alive Link to Nucleotide Sequence:NM_001364997.1Link to Protein Sequence:NP_001351926.1Re-query CCDS DB by Nucleotide ID:NM_001364997Re-query CCDS DB by Protein ID:NP_001351926Link to BLAST:NP_001351926.1
Original member Current member NCBI NM_144860.3 NP_659109.2 Accepted alive Link to Nucleotide Sequence:NM_144860.3Link to Protein Sequence:NP_659109.2Re-query CCDS DB by Nucleotide ID:NM_144860Re-query CCDS DB by Protein ID:NP_659109Link to BLAST:NP_659109.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001351926.1 1006 Q80SY4 1006 100% 0 0
NP_659109.2 1006 Q80SY4 1006 100% 0 0

Chromosomal Locations for CCDS 29058.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 18 (NC_000084.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18See the combined annotation on chromosome 18 in Sequence Viewer

Chromosome Start Stop Links
18 10726305 10726533 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 10740983 10741154 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 10743269 10743398 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 10747356 10747460 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 10749323 10749389 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 10751823 10752027 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 10755504 10755687 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 10760804 10760948 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 10763189 10763322 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 10768124 10768231 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 10775529 10775726 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 10778149 10778300 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 10792895 10793027 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 10794478 10794564 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 10795690 10795851 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 10798352 10798533 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 10800056 10800248 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 10802261 10802339 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 10804687 10804800 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 10808034 10808134 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 10811985 10812125 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3021 nt):
ATGAGTAACTCCCGCAACAACCGAGTGATGGTGGAGGGGGTCGGCGCCCGCGTAGTGCGCGGCCCGGACT
GG
AAGTGGGGCAAGCAGGACGGCGGCGAGGGCCATGTAGGCACTGTACGGAGCTTCGAGAGTCCGGAGGA
G
GTCGTGGTGGTGTGGGACAACGGCACGGCCGCCAACTACCGCTGCTCAGGGGCCTACGACCTGCGTATC
CTG
GACAGCGCGCCCACCGGCATCAAGCATGATGGAACTATGTGTGATACCTGCCGCCAGCAACCAATCA
TT
GGCATTCGATGGAAATGTGCAGAGTGCACCAATTATGATTTGTGCACTGTTTGTTATCATGGAGATAA
A
CATCACTTAAGGCATCGCTTTTATAGGATTACTACACCAGGAAGTGAACGGGTTCTGTTAGAGTCTCGT
AGA
AAATCTAAGAAGATTACAGCCAGAGGAATCTTTGCTGGTGCCAGAGTGGTGCGAGGAGTGGACTGGC
AG
TGGGAAGATCAAGATGGAGGCAATGGGCGTAGAGGAAAGGTCACGGAGATCCAGGACTGGAGTGCATC
C
AGCCCACACAGTGCAGCCTATGTTCTCTGGGATAACGGTGCTAAGAACCTTTACAGGGTTGGCTTTGAG
GGC
ATGTCTGATCTCAAGTGTGTCCAGGATGCCAAAGGAGGTTCTTTCTACAGAGATCATTGCCCTGTGC
TA
GGTGAGCAGAATGGCAACAGGAATCCTGGTGGATTGCAGATTGGTGACCTGGTAAATATAGACCTTGA
T
CTAGAAATTGTCCAGTCTTTACAGCACGGTCATGGAGGATGGACCGATGGCATGTTTGAGACTTTAACT
ACA
ACTGGAACCGTCTGTGGCATTGATGAAGATCATGACATTGTAGTACAGTATCCAAGTGGCAATAGAT
GG
ACTTTCAATCCTGCTGTTCTCACTAAGGCAAACATTGTCCGAAGTGGGGATGCTGCACAGGGTGCAGA
A
GGAGGCACCTCACAGTTTCAAGTGGGTGATCTTGTGCAAGTTTGTTATGATCTGGAAAGAATTAAACTT
CTC
CAAAGAGGACATGGTGAATGGGCTGAAGCAATGCTTCCAACTTTAGGTAAAGTTGGCCGAGTACAAC
AG
ATTTATTCGGACAGTGACTTAAAGGTGGAAGTCTGTGGAACATCTTGGACGTATAACCCTGCAGCAGT
T
TCCAAGGTGGCCCCTGCAGGATCAGCCATTAGCAATGCATCTGGTGAAAGACTCTCCCAGCTTCTGAAG
AAA
TTATTTGAAACCCAAGAATCTGGTGACCTCAATGAAGAGCTGGTTAAGGCTGCTGCCAATGGAGACG
TG
GCTAAAGTGGAAGATTTGCTGAAAAGACCAGATGTGGATGTAAACGGACAGTGTGCTGGCCACACAGC
A
ATGCAAGCTGCTAGTCAGAACGGACATGTTGATATTTTGAAATTACTTTTGAAGCAAAATGTTGATGTT
GAA
GCAGAGGATAAAGATGGAGATCGAGCCGTTCACCATGCAGCCTTTGGAGATGAGGGTGCTGTCATAG
AA
GTCCTACACCGAGGCAGTGCTGACCTGAATGCTCGTAATAAGCGTAGACAGACGCCTCTTCATATTGC
T
GTCAATAAAGGTCATCTTCAAGTTGTGAAGACTTTGTTGGATTTTGGTTGTCATCCCAGTCTCCAGGAT
TCT
GAAGGTGACACCCCTCTCCATGATGCCATAAGTAAGAAACGGGATGACATTCTGGCAGTTCTTCTGG
AA
GCTGGAGCAGATGTGACCATCACGAACAATAACGGGTTCAATGCCCTGCACCATGCTGCACTGAGAGG
G
AACCCCAGTGCAATGCGTGTTTTACTCTCAAAATTACCAAGACCATGGATTGTGGATGAGAAGAAAGAT
GAT
GGTTATACTGCCTTGCACCTGGCTGCCCTGAATAATCATGTGGAAGTGGCTGAGCTGTTGGTGCATC
AG
GGAAATGCAAACCTGGATATCCAGAATGTGAACCAGCAAACAGCCCTACACCTTGCTGTTGAACGGCA
A
CACACCCAGATTGTTAGGCTTTTGGTCCGTGCAGGTGCTAAGCTAGACATTCAGGATAAGGATGGAGAT
ACT
CCTCTGCATGAAGCTTTGAGACATCATACTTTGTCTCAACTACGTCAGCTACAAGACATGCAAGATG
TG
GGCAAGGTAGACGCTGCCTGGGAACCTTCAAAAAACACATTAATAATGGGACTTGGTACCCAGGGGGC
T
GAGAAGAAGAGTGCAGCATCCATTGCGTGTTTCTTGGCAGCCAATGGTGCTGATCTCAGCATTCGAAAT
AAG
AAGGGTCAGTCACCACTGGATCTCTGTCCTGACCCAAGTCTCTGCAAAGCTTTGGCAAAATGTCATA
AG
GAAAAAGTCAGTGGCCAAGTGGGTTCTCGGAGTCCTTCTATGATTAGCAACGATTCTGAAACTTTAGA
G
GAATGTATGGTGTGCTCAGACATGAAGAGAGATACTCTTTTTGGTCCGTGTGGACACATTGCAACCTGT
TCT
TTGTGTTCCCCTCGTGTCAAGAAATGCCTCATTTGTAAAGAGCAGGTTCAGTCCAGGACAAAGATTG
AA
GAATGTGTGGTGTGCTCCGACAAGAAAGCAGCTGTTCTCTTTCAACCTTGTGGGCACATGTGTGCTTG
T
GAGAACTGTGCCAGCCTGATGAAAAAGTGTGTGCAGTGTCGGGCAGTGGTTGAGCGGAGGGTGCCTTTC
ATC
ACGTGCTGTGGTGGCAAGAGCTCAGAAGACCCCTCTGATGAAATCTCAAGTGGGAATATCCCAGTGC
TG
CAGAAGGACAAAGACAACACCAATGTTAACGCAGATGTGCAGAAACTGCAGCAGCAGCTTCAGGACAT
T
AAGGAGCAGACCATGTGCCCTGTGTGCTTGGATCGCCTGAAGAACATGATTTTCCTCTGTGGCCATGGA
ACA
TGCCAGCTCTGTGGAGACCGGATGAGTGAATGCCCAATTTGTCGCAAGGCAATTGAACGAAGGATTC
TT
TTGTACTGA


Translation (1006 aa):
MSNSRNNRVMVEGVGARVVRGPDWKWGKQDGGEGHVGTVRSFESPEEVVVVWDNGTAANYRCSGAYDLRI
L
DSAPT
GIKHDGTMCDTCRQQPIIGIRWKCAECTNYDLCTVCYHGDKHHLRHRFYRITTPGSERVLLESR
R
KSKKITARGIFAGARVVRGVDWQWEDQDGGNGRRGK
VTEIQDWSASSPHSAAYVLWDNGAKNLYRVGFE
G
M
SDLKCVQDAKGGSFYRDHCPVLGEQNGNRNPGGLQIGDLVNIDLDLEIVQSLQHGHGGWTDGMFETLT
T
TGTVCGIDEDHDIVVQYPSGN
RWTFNPAVLTKANIVRSGDAAQGAEGGTSQFQVGDLVQVCYDLERIKL
L
QRGHGEWAEAMLP
TLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVSKVAPAGSAISNASGERLSQLLK
K
LFETQESGDLNEELVKAAANGDVAKVEDLLKRPDVD
VNGQCAGHTAMQAASQNGHVDILKLLLKQNVDV
E
AE
DKDGDRAVHHAAFGDEGAVIEVLHRGSADLNARNKRRQTPLHIAVNKGHLQVVKTLLDFGCHPSLQD
S
EGDTPLHDAISKKRDDILAVLLEAGADVTITNNNGFNALHHAALRGNP
SAMRVLLSKLPRPWIVDEKKD
D
GYTALHLAALNNHVEVAELLVHQ
GNANLDIQNVNQQTALHLAVERQHTQIVRLLVRAGAKLDIQDKDGD
T
PLHEALRHHTLSQLRQLQDMQDVGKVDAAWEPSKNT
LIMGLGTQGAEKKSAASIACFLAANGADLSIRN
K
KGQSPLDLCPDPSLCKALAKCHKEKV
SGQVGSRSPSMISNDSETLEECMVCSDMKRDTLFGPCGHIATC
S
LCSPRVKKCLICKEQVQSRTK
IEECVVCSDKKAAVLFQPCGHMCACENCASLMKKCVQCRAVVERRVPF
I
TCCGGKSSEDPSDEI
SSGNIPVLQKDKDNTNVNADVQKLQQQLQDIKEQTMCPVCLDRLKNMIFLCGHG
T
CQLCGDRMSECPICRKAIERRILLY




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser