NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS29003.2 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
29003.2 Public Mus musculus 17 Lrpprc 21 106 86 CCDS HistoryNCBI Gene:72416Re-query CCDS DB by CCDS ID:29003.2Re-query CCDS DB by GeneID:72416See the combined annotation on chromosome 17 in Sequence Viewer

Public Note for CCDS 29003.2
The coding region has been updated to extend the N-terminus to one that is more supported by available transcript and homology data.

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq, Havana and CCDS collaboration)

Sequence IDs included in CCDS 29003.2

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000112308 ENSMUSP00000107927 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000112308Link to Ensembl Protein Viewer:ENSMUSP00000107927Re-query CCDS DB by Nucleotide ID:ENSMUST00000112308Re-query CCDS DB by Protein ID:ENSMUSP00000107927
Original member Current member EBI,WTSI OTTMUST00000076447 OTTMUSP00000040245 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000076447Link to Vega Protein Viewer:OTTMUSP00000040245Re-query CCDS DB by Nucleotide ID:OTTMUST00000076447Re-query CCDS DB by Protein ID:OTTMUSP00000040245
Original member Current member NCBI NM_028233.2 NP_082509.2 Accepted alive Link to Nucleotide Sequence:NM_028233.2Link to Protein Sequence:NP_082509.2Re-query CCDS DB by Nucleotide ID:NM_028233Re-query CCDS DB by Protein ID:NP_082509Link to BLAST:NP_082509.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_082509.2 1392 Q6PB66 1392 100% 0 0

Chromosomal Locations for CCDS 29003.2

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 17 (NC_000083.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17See the combined annotation on chromosome 17 in Sequence Viewer

Chromosome Start Stop Links
17 84705416 84705472 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 84705899 84706041 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 84707094 84707178 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 84708088 84708162 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 84710291 84710406 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 84710535 84710674 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 84712693 84712894 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 84716627 84716715 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 84722697 84722823 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 84726303 84726411 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 84726530 84726672 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 84731145 84731235 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 84731749 84731817 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 84740070 84740176 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 84740544 84740668 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 84748961 84749168 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 84750508 84750593 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 84751224 84751354 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 84752309 84752422 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 84752729 84752773 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 84753114 84753191 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 84753405 84753511 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 84754541 84754598 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 84756258 84756285 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 84761952 84762018 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 84764452 84764545 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 84766993 84767111 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 84769595 84769702 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 84770000 84770105 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 84770354 84770499 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 84770843 84770987 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 84771424 84771550 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 84772093 84772179 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 84773044 84773102 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 84773208 84773329 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 84775389 84775511 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 84776941 84777134 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 84790365 84790513 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (4179 nt):
ATGGCAGCCCTGCTGAGACCCGCGCGTTGGCTGCTCGGGGCCGCGGCGGCCCCGCGCCTCCCGCTGTCCC
TG
CGCCTCCCTGCGGGCGTCCCGGGCCGGCTGTCCTCCGTCGTCCGGGTCGCGGCTGTTGGTAGCCGGCC
G
GCTGCAGGAGAGCGTCTGAGCCAAGCCAGATTGTATGCCATCGTTGCTGAGAAAAGGGATCTTCAAGAG
GAG
CCTGCTCCTGTGAGAAAGAACAGCAGTCAATTTGACTGGGCTCTGATGAGACTGGATAATTCTGTCC
GG
AGAACAGGCCGCATCACAAAGGGGCTTCTGCAGAGAGTCTTTGAGAGCACGTGTAGCTCAGGTAGCCC
A
GGGAGCAATCAAGCTCTGCTTCTGCTGCGCAGCTGTGGCTCGCTCCTGCCCGAACTGAGTCTCGCCGAG
AGG
ACAGAGTTTGCTCACAAGATCTGGGACAAACTTCAGCAGTTAGGTGTCGTATATGATGTCAGTCATT
AC
AATGCTTTACTTAAAGTATATCTTCAAAATGAATACAAATTTTCACCTACTGACTTCCTGGCAAAGAT
G
GAGGGAGCAAACATCCAACCAAATCGAGTAACATACCAGAGGCTGATAGCTGCCTACTGTAATGTTGGG
GAC
ATTGAAGGTGCCAGCAAGATCCTTGGATTTATGAAAACGAAAGACCTTCCGATCACAGAGGCCGTGT
TC
AGTGCTCTCGTCACAGGGCATGCGAGAGCTGGGGATATGGAAAATGCAGAAAATATTCTCACAGTGAT
G
AAACAGGCCGGCATTGAGCCTGGCCCAGACACGTATCTGGCCTTGTTGAATGCACATGCTGAGAGGGGT
GAC
ATTGGCCAGGTTAGGCAGATTCTGGAGAAAGTGGAGAAGTCAGACCATTACTTCATGGACCGCGACT
TC
TTGCAGGTTATTTTTAGCTTCAGTAAGGCTGGCTACCCTCAGTATGTCTCAGAAATACTGGAGAAGAT
T
ACCTATGAGAGACGGTCTATTCCAGATGCAATGAACCTCATTTTGTTTTTAGCCACTGAGAAGTTAGAA
GAC
ACTGCGTTCCAGGTTTTATTGGCATTACCCCTGTCCAAGGACGAGAGCTCCGATAACTTTGGCAGTT
TC
TTTTTGCGGCACTGTGTGACTCTGGATTTGCCCCCTGAGAAGCTGATAGACTACTGTCGGAGGCTGAG
G
GACGCCAAGCTGCACAGCTCCTCACTGCAGTTCACGCTGCACTGTGCTCTTCAAGCCAATAGGACAGCT
TTG
GCAAAAGCAGTGATGGAGGCTTTGAGGGAAGAAGGGTTTCCTATCCGACCGCACTATTTCTGGCCGT
TG
CTTGCTGGGCATCAGAAAACAAAAAATGTTCAAGGAATAATAGATATCCTCAAAATAATGAACAAAGT
G
GGAGTGGATCCTGATCAGGAAACATATATAAACTATGTGTTTCCGTGCTTTGATAGTGCACAGTCAGTT
CGA
GCTGCTTTGCAGGAAAATGAATGTCTCCTCGCAAGTAGTACCTTTGCTCAAGCTGAAGTGAAGAATG
AA
GCAATAAATGGGAACTTACAGAACATTTTGTCATTTTTGGAATCGAATACATTGCCTTTCTCGTTTAG
T
TCTTTGAGAAACAGCCTAATCCTAGGCTTCAGGAGGTCGATGAACATAGATCTTTGGAGCAAGATAACA
GAA
TTGTTGTACAAGGATGAACGCTATTGCTCAAAGCCTCCGGGACCAGCGGAAGCTGTTGGCTATTTTC
TT
TATAACTTGATTGACAGCATGAGTGACTCAGAGGTACAGGCCAAGGAGGAGCGTTTGAGACAATACTT
C
CATCAGCTGCAGGAGATGAATGTTAAAGTTCCTGAAAACATCTACAAAGGCATTTGTAATTTGCTGAAT
ACC
TACCATGTTCCTGAATTGATTAAGGATATTAAGGTTCTGGTTGACAGAGAGAAGGTAGATTCTCAAA
AA
ACTTCTCAAGTTACCTCATCTGATTTGGAATCAACACTTGAGAAACTCAAAGCTGAAGGCCAACCTGT
A
GGATCTGCCCTGAAGCAGCTCCTGCTGCTGCTCTGCTCAGAGGAGAATATGCAAAAGGCCCTTGAGGTG
AAA
GCAAAATATGAGTCAGACATGGTTATTGGTGGCTATGCAGCATTAATAAATTTGTGCTGTCGACATG
AT
AATGCAGAAGATGCGTGGAACTTGAAACAAGAAGTTGACCGCTTAGATGCTTCGGCTATTCTTGACAC
T
GCCAAGTACGTAGCCCTTGTAAAAGTACTGGGAAAGCACAGCAGACTCCAAGATGCTATTAACATTCTA
AAG
GAGATGAAAGAGAAGGATGTTGTTATCAAAGATGCAACAGTCTTGTCCTTTTTCCACATCCTCAATG
GT
GCAGCTTTAAGAGGTGAAATTGAAACAGTAAAACAGCTGCATGAAGCCATCGTGACTCTTGGGTTGGC
A
AAGCCGTCCAGCAACATAAGCTTCCCGTTGGTCACTGTGCACCTGGAAAAGGGTGACTTACCTGCTGCT
CTT
GAAGCCAGCATTGCCTGCCATAAAAAATATAAAGTGTTACCCAGGATTCATGATGTCTTATGTAAGC
TA
GTAGAGAAAGGCGAGACTGATTTGATCCAGAAAGCAATGGACTTTGTGAGCCAAGAACAAGGGGAGAT
G
ACGATGCTCTACGACCTCTTCTTTGCTTTCCTGCAGACGGGGAATTACAAAGAAGCTAAGAAGATCATT
GAG
ACTCCAGGCATTAGAGCTCGGCCTACAAGACTCCAGTGGTTTTGTGATCGATGCATTGCCAGTAATC
AG
GTTGAAGCTCTTGAGAAGTTGGTAGAGCTGACTGAGAAGCTGTTTGAGTGTGACAGAGACCAGATGTA
C
TACAACTTACTGAAGCTATACAAAATAAGCAGTGACTGGCAAAGAGCGGATGCTGCGTGGACCAAAATG
CAA
GAAGAGAACATTATCCCTCGAGAGCGGACACTGCGGCTCTTAGCCGAGATCTTGAAAACCAGCAACC
AG
GAAGTTCCTTTCGACGTTCCGGAGTTGTGGTTTGGAGATGACAGACCTTCCCTGAGTCCATCCTCACG
C
TCAGCAGGAGAGGACGTTACTGAGAAGACGTTGTTGTCTAACTGCAAACTAAAGAAGAGTAAAGATGCA
TAT
AATATCTTCCTTAAAGCCGAAAAGCAAAACGTTGTATTTAGCAGTGAAACTTATAGCACCTTGATAG
GC
TTGCTGCTGAGTAAGGACGACTTCACCCAAGCAATGCACGTGAAGGATTTCGCTGAGACCCACATCAA
G
GGCTTCACACTGAACGATGCTGCCAACAGCCTCCTCATCATAAGGCAAGTTAGGCGGGATTATTTGAAA
G
GG
GCTCTGGCAACTCTGAGAGCAGCCTTGGATTTGAAGCAGGTTCCGTCCCAGATCGCCGTGACCCGCC
TC
ATCCAGGCGTTGGCCTTGAAGGGTGATGTGGAAAGCATAGAGGCCATTCAGAGAATGGTGGCTGGACT
T
GACACGATTGGACTCTCAAAAATGGTTTTTATCAATAACATCGCTTTGGCCCAGATGAAGAATAATAAA
CTT
GATGCTGCCATAGAAAACATTGAGCACCTGCTTGCTTCCGAGAACCAAGCCATAGAACCTCAGTACT
TT
GGCTTGTCGTATCTATTCAGAAAAGTGATCGAAGAGCAGATGGAACCAGCGCTAGAGAAGTTAAGCAT
C
ATGTCTGAGAGAATGGCGAATCAGTTTGCACTTTACAAGCCCGTCACTGATCTATTCCTGCAGCTTGTG
GAT
TCAGGCAAGGTGGATGAGGCCAGAGCTCTCTTAGAGAGATGCGGTGCCATTGCCGAGCAGAGCTCGC
TT
CTGTCGGTGTTCTGTCTGAGGACTTCTCAGAAACCGAAAAAGGCACCAGTTCTGAAGACTTTGTTAGA
A
CTGATTCCTGAGTTACGTGATAACGATAAAGTATATTCTTGCAGCATGAAAAGCTATGCCTTAGACAAA
GAT
GTGGCCTCGGCTAAAGCACTGTATGAGTATTTGACAGCCAAGAACTTGAAGCTAGATGACCTGTTTC
TC
AAGCGCTATGCAGCTTTGCTCAAGGATGTCGGCGAACCAGTCCCCTTCCCCGAGCCCCCTGAAAGCTT
T
GCATTTTATATAAAGCAACTAAAGGAAGCAAGGGAAAGCCCTTCATGA


Translation (1392 aa):
MAALLRPARWLLGAAAAPRLPLSLRLPAGVPGRLSSVVRVAAVGSRPAAGERLSQARLYAIVAEKRDLQE
E
PAPVRKNSSQFDWALMRLDNSVRRTGRITKGLLQRVFESTCSS
GSPGSNQALLLLRSCGSLLPELSLAE
R
TEFAHKIWDKLQQL
GVVYDVSHYNALLKVYLQNEYKFSPTDFLAKMEGANIQPNRVTYQRLIAAYCNVG
D
IEGA
SKILGFMKTKDLPITEAVFSALVTGHARAGDMENAENILTVMKQAGIEPGPDTYLALLNAHAERG
D
IGQVRQ
ILEKVEKSDHYFMDRDFLQVIFSFSKAGYPQYVSEILEKITYERRSIPDAMNLILFLATEKLE
D
TAFQVLLALPLSKDESSDNFGSFFLRHCVTLDL
PPEKLIDYCRRLRDAKLHSSSLQFTLHCALQANRTA
L
AKAVMEALREEGFPIRPHYFWPLLAGHQKTKNVQ
GIIDILKIMNKVGVDPDQETYINYVFPCFDSAQSV
R
AALQ
ENECLLASSTFAQAEVKNEAINGNLQNILSFLESNTLPFSFSSLRNSLILGFRRSMNIDLWSKIT
E
LLYKDERYCSKPPGPA
EAVGYFLYNLIDSMSDSEVQAKEERLRQYFHQLQEMNVKVPENIYKGICNLLN
T
YHVPELIK
DIKVLVDREKVDSQKTSQVTSSDLESTLEKLKAEGQPVGSALKQLLLLLCSEENMQKALEV
K
AKYESDMVIGGYAALINLCCRHDNAEDAWNLKQE
VDRLDASAILDTAKYVALVKVLGKHSRLQDAINIL
K
EMKEKDVVIKDATVLSFFHILNGAALRGEIETVKQLHEAIVTLGLAKPSSNISFPLVTVHLE
KGDLPAA
L
EASIACHKKYKVLPRIHDVLCKLVEKGETDLIQK
AMDFVSQEQGEMTMLYDLFFAFLQTGNYKEAKKII
E
TPGIRARPTRLQWFCDRCIASNQVEALEKLVELTEKLFECDRDQMYYNLLKLYKISSDWQRADAAWTKM
Q
EENIIPRERTLRLLAEILKTSNQEVPFDVPE
LWFGDDRPSLSPSSRSAGEDVTEKTLLSNCKLKKSKDA
Y
NIFLKAEKQNVVFSSETYSTLIGLLLSKDDFTQAMHVKD
FAETHIKGFTLNDAANSLLIIRQVRRDYLK
G
ALATLRAALDLKQVPSQIAVTRLIQALALKGDVESIEAIQRMVAGLDTIGLSKMVFINNIALAQMKNNK
L
DAAIENIEHLLASENQAIEPQYFGLSYLFRKVIEEQMEPALEK
LSIMSERMANQFALYKPVTDLFLQLV
D
SGKVDEARALLE
RCGAIAEQSSLLSVFCLRTSQKPKKAPVLKTLLELIPELRDNDKVYSCSMKSYALDK
D
VASAKALYEYLTAKNLKLDDLFLKRYAALLKDVGEPVPFPEPP
ESFAFYIKQLKEARESPS



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser