NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS28999.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
28999.1 Public Mus musculus 17 Plekhh2 23 108 98 CCDS HistoryNCBI Gene:213556Re-query CCDS DB by CCDS ID:28999.1Re-query CCDS DB by GeneID:213556See the combined annotation on chromosome 17 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 28999.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000047206.6 ENSMUSP00000039628.5 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000047206.6Link to Ensembl Protein Viewer:ENSMUSP00000039628.5Re-query CCDS DB by Nucleotide ID:ENSMUST00000047206Re-query CCDS DB by Protein ID:ENSMUSP00000039628
Original member Current member NCBI NM_001357986.1 NP_001344915.1 Accepted alive Link to Nucleotide Sequence:NM_001357986.1Link to Protein Sequence:NP_001344915.1Re-query CCDS DB by Nucleotide ID:NM_001357986Re-query CCDS DB by Protein ID:NP_001344915Link to BLAST:NP_001344915.1
Original member Current member NCBI NM_177606.4 NP_808274.2 Accepted alive Link to Nucleotide Sequence:NM_177606.4Link to Protein Sequence:NP_808274.2Re-query CCDS DB by Nucleotide ID:NM_177606Re-query CCDS DB by Protein ID:NP_808274Link to BLAST:NP_808274.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001344915.1 1491 Q8C115-1 1491 100% 0 0
NP_808274.2 1491 Q8C115-1 1491 100% 0 0

Chromosomal Locations for CCDS 28999.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 17 (NC_000083.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17See the combined annotation on chromosome 17 in Sequence Viewer

Chromosome Start Stop Links
17 84521703 84521825 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 84547463 84547525 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 84557372 84557521 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 84559490 84559573 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 84560088 84560169 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 84563818 84563997 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 84565971 84566935 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 84569876 84569951 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 84571042 84571136 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 84571668 84571812 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 84574931 84575067 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 84575167 84575277 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 84575717 84575803 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 84577158 84577316 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 84583465 84583545 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 84586297 84586476 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 84589385 84589493 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 84590760 84590872 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 84591537 84591716 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 84596208 84596305 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 84597898 84598075 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 84599135 84599290 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 84600685 84600782 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 84606821 84606962 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 84610757 84610902 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 84611638 84611767 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 84616177 84616263 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 84617932 84618066 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 84619624 84619809 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (4476 nt):
ATGGAGGAGCCCTCTGAGCCAGAAGGACTAATAGACTGGAAAGAGCGCTGCGTAGCTCTGGAGGCTCAGC
TC
ATGAAATTCCGAGTTCAAGCAAGCAAGATCCGCGAGCTCTTAGCAGACAAAATGCAACAGTTGGAGAG
A
CAAGTTATCGATGCAGAGCGGCAAGCAGAAAAGGCTTTTCAAGAGGTACAAGTTATGGAAGAGAAACTA
AAA
GCAGCTAATATTCAGACCAGTGAGTCGGAGACACGGCTCTATAAGAAGTGTCAGGACCTGGAGTCCG
TG
ATGCAGGAGAAGGATGACATCATTCAGAACTTGGCGCTGCGGCTTGAAGAGCAGAAACAAGTGAGGAT
A
CAAGAAGCTAAAATAATAGAAGAAAAAGCAGCTAAGATCAAAGAATGGGTAACAGTTAAGTTAAACGAG
CTA
GAAGTAGAGAATCAGAATCTTCGTTTCATCAACCAGACCCAGACTGAAGAGATAAGAGCGATACAGT
CC
AAGTTGCAAGAACTCCAAGAGAAGAAGATATCCTGTGTCTCCTCACCAAAGACCTCAGAAGGGCAACG
C
AATTTGACATTTGGATGCTTCTTGTCCCGAGCAAAGAGTCCTCCTTGTGTCGTAAGATGTGAGGAAGTG
AGC
AAGATGGCCTCAAATGAACCTGAGATCACGGAAGGAAGATGTGTAGAAGAGATGGAAATTGCAGAGA
AG
CCTGCTGACAACCAAGTCCAAGAGAACAGCAGAAGCCAGAGAAAGTTGCACGAGACCTCTTGCAGCTC
G
GAACAGAACCAGAAAACGAGAGCAAGCTTTGCAATGGATGGTGGTACGTCCCAGAATTCTGGGGTTCCA
GTG
AGTGACTGGAGTTCAGACGAGGATGATGGAAGCAAGGGCAGATCTAAGTCCAGGTGCACGTCCACCC
TT
TCCAGCCACACATCTGAGGAGGGTGGCCAGTGCGGCAGGCTGGGCAGCGAAGCCTACCTCACAGCATC
T
GATGACAGTAGTTCTATATTCGAAGAAGAGACTTTTGATGGGAATAGACCTGAGCAAAAGAAGCTGTGT
TCT
TGGCAGCAGAAGGCACCATGGAAAGCTCAGGGTAACCTTGCAAAAGGGAGGTCTCAGTCAGGAGTAA
AG
GAGCAAGATAGTTCCTCAGATGAACTGAATAAGAAATTTCACTCGCAGAGACTGGATTATACATCCTC
A
TCCAGCGAGGCCAACACCCCAAGCCCTATTTTAACCCCAGCTTTAACTCCCAGGTACCCTAACTCACTC
CCT
GGAAAAGGAGGAGCCCCGTTAGTGCCTCCTCCATTCCAGCCACCCCCAAAGCTCAGGGTCCCCAACG
TT
TTCAGTATAAGTGTGGCACTCACCAAGAGACACCTGAGCCAGCCACAGCTATGCTCCGATCGGATGTT
T
GGCACGAACCGGAACGCCATAAGCATGATCCGGCCGCTGAGGCCCCAGGAAACGGACCTTGATGTGGTT
GAT
GGGGACGGGGCCGAGGCTGTGAACAGAATGGACACTGGTTGCGATGACGGCTTATTTTCCTATGACT
CC
CAGGATCCTCCTCCGTGTGCAGATGACCAGGAAAACAGCGAGGCCCCAAAGAAGGCCCCATGCAACAA
A
CCCCCTACTCCTCCTCTGCACCGCTTCCCCTCTTGGGAGAGCAGGATATATGCTGTAGCCAAATCAGGC
ATC
CGGGTGTCTGAGGCCTTCAATATGGAGCATGCTAATAAAAATTCTGCAGACATACTTTCCTACTCTG
CA
GCAAGCCTTTATACGTCTCTCATATACAAGAACATGACGACCCCAGTCTATACAACGTTGAAGGGGAA
G
GCGACACAAATAAGTAGCAGCCCTTTCCTGGATGACTCCTCGGGCTCAGACGAAGAGGACAGTTCTAGG
TCC
AGCTCCCGGCTGTCGGAGTCAGATGCGCGCAGTCGCAGTGGGCCAAGCAGTCCCAGAGCCATGAAGC
GA
GGCGTGTCTGACTCCTCCGCAGCTTCTGAAAGTGACTATGCCATTCCTCCGGATGCCTATCCCATAGA
C
GCAGAGTGTTCGCAGCCCGAGCAGAAACTTCTAAAAACCTGCCTGGCCTCCTGTGACAATGGGAAAAAT
GAA
CCATTAGAAAAATCTGGGTACCTACTGAAAATGAGCGTGAGAGTCAAGACTTGGAAGCGGAGGTGGT
TT
GTTCTGAAAGGAGGCGAATTACTTTACTACAAGTCACCAAGCGATGTGATTCGGAAACCCCAGGGCCA
C
ATTGAACTGAGTGCATCCTGCAGTATTTTACGGGGCGATAACAAGCAAACGGTTCAGCTGGCCACAGAG
AAG
CACACATACTATCTGACGGCGGATTCTCCCAATATACTGGAAGAATGGATCAAAGTGTTACAGAGCG
TT
CTGCGAGTACAAGCTGCGAACCCTCTTTGCCTGCAGCCTGAGGGCAAACCCGCAGTAAAGGGCTTGCT
C
ACCAAGGTGAAGCATGGCTACTCTAAGAGGGTCTGGTGCATGCTTGTTGGAAAGGTCTTGTATTATTTC
CGC
AATCAAGAGGATAAGTTCCCTCTAGGTCAGCTCAAACTCTGGGAGGCTAAGGTGGAAGAGGTGGACA
GG
TCCTGTGACTCCGACGAGGACTATGAGACCCGGGGGTGCTATCTGCTGTCCACTCACTACACCATCAT
T
GTCCACCCCAAAGACCAGGGCCCTACTTACCTGCTCATCGGATCTAAGCACGAGAAGGAAGCTTGGCTG
TAT
CACCTCACTGTTGCAGCTGGAAGCAACAATATAAATGTTGGATCCGAATTTGAACAACTGGTTTGCA
AG
TTGCTGAATATAGAAGGGGAGCCCTCCTCCCAGATATGGAGACACCCCATGCTGTGTCACAGCAAAGA
A
GGAATTCTGTCCCCTCTGACCACACTGCCTTCGGAAGCTCTGCAGACCGAGGCCATTAAGCTATTTAAG
ACC
TGCCAGCTCTTTATAAACGCTGCGGTCGACTCCCCTGCCATCGACTACCACATCTCTCTAGCCCAGA
GC
GCTCTGCAGGTCTGCCTGACGCATCCCGAGCTACAGAATGAAATCTGCTGCCAGCTTATTAAGCAGAC
A
AGACGGAGACAGCTGCAGAACCAGCCAGGCCCGCTGCAGGGTTGGCAGCTCTTGGCACTCTGCGTTGGA
CTC
TTCCTTCCCCACCACCCTTTCCTGTGGCTCCTCCAGCTCCATCTACAAAGGAATGCAGATTCCAGGA
CA
GAGTTTGGGAAATATGCCATTTACTGCCAGCGATGTGTAGAAAGGACACAGCAAAACGGAGACCGAGA
G
GCCAGACCGTCCAGGATGGAGATACTCTCCACTCTTCTTCGAAACCCCTACCACCATTCTCGGCCCTTC
AGC
ATACCCGTGCACTTCATGAACGGGCTCTACCAGGTAGTGGGGTTCGATGCGTCCACCACAGTGGAAG
AA
TTTTTGAACACTCTGAACCAGGACACAGGAATGAGGAAGCCGGCACAGTCTGGATTCGCACTCTTCAC
A
GATGATCCTTCTGGCAGAGACCTGGAGCACTGTCTTCAGGGAAATATCAAGATCTGTGACATTATTTCT
AAA
TGGGAGCAGGCATCCAAAGAACAGCAGCCAGGCAAGTGTGAGGGCAGCCGGACTGTCCGTCTGACTT
AC
AAAAACAGACTGTATTTCTCAGTGCAAGCTCGTGGAGAAACCGATAGAGAGAAGACGCTGCTGCTGTA
C
CAGACAAATGACCAAATCATAAACGGCCTTTTTCCTCTGAATAAGGATCTGGCGTTAGAAATGGCAGCG
CTT
TTAGCTCAGGTGGATATTGGAGATTTTGAAAGACCTTTCTCAACTCCAGCGGGGCCTGTGACTAACC
AG
TGCAAGGCAAATCAAACCCTCAAACAAGTCATAGAGAGATTTTACCCGAAAAGGTACCGAGAAGGGTG
C
TCTGAGGAGCAGCTAAGGCAGCTCTACCAGCGACTCTCAACCAAATGGATGGCCCTCCGGGGACACAGT
GCG
GCTGACTGCATTCGAATTTACTTGACAGTAGCCAGGAAGTGGCCGTTCTTTGGCGCCAAGTTGTTCT
TT
GCAAAACCAATAGCACCATCATCACTTGGCAATAATTGCGTGTGGCTGGCTGTCCATGAAAATGGGTT
G
AGCATCCTAGAATACACCTCCATGAGATTAGTGACCAGCTATATGTACAAAGGTCTGATGACCTTTGGG
GGC
TATCAAGAGGATTTCATGGTAGTCGTTAGTACACAGTCAAAAGACCGGCCAACAGAGAAGTTACTTT
TT
GCGATGGCAAAACACAAGATTCTTGAAATCACCCTTCTGATCGCCAGTTACATCAACAGCTTCCATCA
A
CAGAAGACAACGTTTCACCACCTCTCTGCCCCAGCGCTGCTCTCACCCAGGACCCAGGCGCCCCAAGCC
AGG
GTCATGGGCAGCCAGCCCCCTCTGTCCAACAGCAGACCTACCAAAGGCCCTACCTTACTCTGA


Translation (1491 aa):
MEEPSEPEGLIDWKERCVALEAQLMKFRVQASKIRELLADKMQQLERQVIDAERQAEKAFQEVQVMEEKL
K
AANIQTSESETRLYKKCQDLESVMQEKDDIIQNLALRLEEQ
KQVRIQEAKIIEEKAAKIKEWVTVKLNE
L
EVENQNLRFINQTQTEEIRAIQSKLQ
ELQEKKISCVSSPKTSEGQRNLTFGCFLSRAKSPPCVVRCEEV
S
KMASNEPEITEGRCVE
EMEIAEKPADNQVQENSRSQRKLHETSCSSEQNQKTRASFAMDGGTSQNSGVP
V
SDWSSDEDDGSKGRSKSRCTSTLSSHTSEEGGQCGRLGSEAYLTASDDSSSIFEEETFDGNRPEQKKLC
S
WQQKAPWKAQGNLAKGRSQSGVKEQDSSSDELNKKFHSQRLDYTSSSSEANTPSPILTPALTPRYPNSL
P
GKGGAPLVPPPFQPPPKLRVPNVFSISVALTKRHLSQPQLCSDRMFGTNRNAISMIRPLRPQETDLDVV
D
GDGAEAVNRMDTGCDDGLFSYDSQDPPPCADDQENSEAPKKAPCNKPPTPPLHRFPSW
ESRIYAVAKSG
I
RVSEAFNMEHANK
NSADILSYSAASLYTSLIYKNMTTPVYTTLKGKATQISSSPFLDDSSGSDEEDSSR
S
SSRLSESDARSRSGPSSPRAMKR
GVSDSSAASESDYAIPPDAYPIDAECSQPEQKLLKTCLASCDNGKN
E
PLEKSGYLLKMSVRVKTWKRRWFVLKGGELLYYKSP
SDVIRKPQGHIELSASCSILRGDNKQTVQLATE
K
HTYYLTADSPNILEEWIKVLQSVLRVQAANPLCLQPEGKPAVKGLLTK
VKHGYSKRVWCMLVGKVLYYF
R
NQEDK
FPLGQLKLWEAKVEEVDRSCDSDEDYETRGCYLLSTHYTIIVHPKDQGPTYLLIGSKHEKEAWL
Y
HLTVAAGSNNINVGSEFEQLVCKLLNIEGEP
SSQIWRHPMLCHSKEGILSPLTTLPSEALQTEAIKLFK
T
CQLFINAAVDSPAIDYHISLAQSALQVCLTHPELQNEICCQLIKQTRRRQLQNQPGPLQ
GWQLLALCVG
L
FLPHHPFLWLLQLHLQRNADS
RTEFGKYAIYCQRCVERTQQNGDREARPSRMEILSTLLRNPYHHSRPF
S
IPVHFMNGLYQ
VVGFDASTTVEEFLNTLNQDTGMRKPAQSGFALFTDDPSGRDLEHCLQGNIKICDIIS
K
WEQASKEQQPGKCEGSRTVRLTYKN
RLYFSVQARGETDREKTLLLYQTNDQIINGLFPLNKDLALEMAA
L
LAQ
VDIGDFERPFSTPAGPVTNQCKANQTLKQVIERFYPKRYREGCSEEQLRQLYQRLSTKWMALRGHS
A
ADCIRIYLTVARKWPFFGAKLFFAK
PIAPSSLGNNCVWLAVHENGLSILEYTSMRLVTSYMYKGLMTFG
G
YQEDFMVVVSTQSKDRPTEKLLFAMAKHK
ILEITLLIASYINSFHQQKTTFHHLSAPALLSPRTQAPQA
R
VMGSQPPLSNSRPTKGPTLL




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser