NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS28927.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
28927.1 Public Mus musculus 17 Cd70 21 106 86 CCDS HistoryNCBI Gene:21948Re-query CCDS DB by CCDS ID:28927.1Re-query CCDS DB by GeneID:21948See the combined annotation on chromosome 17 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 28927.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000019633 ENSMUSP00000019633 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000019633Link to Ensembl Protein Viewer:ENSMUSP00000019633Re-query CCDS DB by Nucleotide ID:ENSMUST00000019633Re-query CCDS DB by Protein ID:ENSMUSP00000019633
Original member Current member NCBI NM_011617.2 NP_035747.1 Accepted alive Link to Nucleotide Sequence:NM_011617.2Link to Protein Sequence:NP_035747.1Re-query CCDS DB by Nucleotide ID:NM_011617Re-query CCDS DB by Protein ID:NP_035747Link to BLAST:NP_035747.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_035747.1 195 O55237 195 100% 0 0

Chromosomal Locations for CCDS 28927.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 17 (NC_000083.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17See the combined annotation on chromosome 17 in Sequence Viewer

Chromosome Start Stop Links
17 57146075 57146460 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 57148767 57148800 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 57149434 57149601 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (588 nt):
ATGCCGGAGGAAGGTCGCCCTTGCCCCTGGGTTCGCTGGAGCGGGACCGCGTTCCAGCGCCAATGGCCAT
GG
CTGCTGCTGGTGGTGTTTATTACTGTGTTTTGCTGTTGGTTTCATTGTAGCGGACTACTCAGTAAGCA
G
CAACAGAGGCTGCTGGAGCACCCTGAGCCGCACACAGCTGAGTTACAGCTGAATCTCACAGTTCCTCGG
AAG
GACCCCACACTGCGCTGGGGAGCAGGCCCAGCCTTGGGAAGGTCCTTCACACACGGACCAGAGCTGG
AG
GAGGGCCATCTGCGTATCCATCAAGATGGCCTCTACAGGCTGCATATCCAGGTGACACTGGCCAACTG
C
TCTTCCCCAGGCAGCACCCTGCAGCACAGGGCCACCCTGGCTGTGGGCATCTGCTCCCCCGCTGCGCAC
GGC
ATCAGCTTGCTGCGTGGGCGCTTTGGACAGGACTGTACAGTGGCATTACAGCGCCTGACATACCTGG
TC
CACGGAGATGTCCTCTGTACCAACCTCACCCTGCCTCTGCTGCCGTCCCGCAACGCTGATGAGACCTT
C
TTTGGAGTTCAGTGGATATGCCCTTGA


Translation (195 aa):
MPEEGRPCPWVRWSGTAFQRQWPWLLLVVFITVFCCWFHCSGLLSKQQQRLLEHPEPHTAELQLNLTVPR
K
DPTLRWGAGPALGRSFTHGPELEEGHLRIHQDGLYRLHIQVTLANCSSPGSTLQHRATLAVGICSPAAH
G
ISLLRGRFGQDCTVALQRLTYLVHGDVLCTNLTLPLLPSRNADETFFGVQWICP




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser