NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS28840.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
28840.1 Public Mus musculus 17 Ptcra 21 106 86 CCDS HistoryNCBI Gene:19208Re-query CCDS DB by CCDS ID:28840.1Re-query CCDS DB by GeneID:19208See the combined annotation on chromosome 17 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 28840.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000041012 ENSMUSP00000035683 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000041012Link to Ensembl Protein Viewer:ENSMUSP00000035683Re-query CCDS DB by Nucleotide ID:ENSMUST00000041012Re-query CCDS DB by Protein ID:ENSMUSP00000035683
Original member Current member EBI,WTSI OTTMUST00000118474 OTTMUSP00000066121 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000118474Link to Vega Protein Viewer:OTTMUSP00000066121Re-query CCDS DB by Nucleotide ID:OTTMUST00000118474Re-query CCDS DB by Protein ID:OTTMUSP00000066121
Original member Current member NCBI NM_011195.2 NP_035325.1 Accepted alive Link to Nucleotide Sequence:NM_011195.2Link to Protein Sequence:NP_035325.1Re-query CCDS DB by Nucleotide ID:NM_011195Re-query CCDS DB by Protein ID:NP_035325Link to BLAST:NP_035325.1

Chromosomal Locations for CCDS 28840.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 17 (NC_000083.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17See the combined annotation on chromosome 17 in Sequence Viewer

Chromosome Start Stop Links
17 46756227 46756402 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 46757020 46757064 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 46758544 46758864 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 46763536 46763614 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (621 nt):
ATGCTTCTCCACGAGTGGGCCATGGCTAGGACATGGCTGCTGCTGCTTCTGGGCGTCAGGTGTCAGGCTC
TA
CCATCAGGCATCGCTGGCACCCCCTTTCCGTCTCTGGCTCCACCCATCACACTGCTGGTAGATGGAAG
G
CAGCACATGCTGGTGGTTTGCCTGGTCCTCGATGCGGCACCCCCTGGCCTTGACAACCCTGTCTGGTTC
TCA
GCTGGCAATGGCAGTGCCCTAGACGCCTTCACCTATGGGCCCTCTCTGGCACCGGACGGCACCTGGA
CT
AGCCTGGCCCAGCTCTCCTTGCCTTCTGAAGAGCTGGAAGCCTGGGAGCCCTTGGTCTGTCACACCAG
G
CCTGGGGCTGGGGGACAGAACCGGAGCACACACCCCCTCCAGCTGTCAGGGGAATCTTCGACAGCCAGG
AGC
TGCTTTCCGGAGCCTCTCGGGGGGACACAGCGGCAGGTACTGTGGCTGAGCCTACTGCGCCTGCTCC
TC
TTCAAACTGCTTCTGCTCGATGTGCTCCTGACCTGCAGCCACCTCCGCCTCCATGTGCTGGCGGGCCA
G
CACCTCCAGCCACCACCCTCACGCAAGTCCCTGCCTCCCACCCACAGAATTTGGACATAG


Translation (206 aa):
MLLHEWAMARTWLLLLLGVRCQALPSGIAGTPFPSLAPPITLLVDGRQHMLVVCLVLDAAPPGLDNPVWF
S
AGNGSALDAFTYGPSLAPDGTWTSLAQLSLPSEELEAWEPLVCHTRPGAGGQNRSTHPLQLS
GESSTAR
S
CFPEPLG
GTQRQVLWLSLLRLLLFKLLLLDVLLTCSHLRLHVLAGQHLQPPPSRKSLPPTHRIWT



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser