NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS28624.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
28624.1 Reviewed, withdrawal pending Mus musculus 17 Phf8-ps 21 106 86 CCDS HistoryNCBI Gene:74042Re-query CCDS DB by CCDS ID:28624.1Re-query CCDS DB by GeneID:74042See the combined annotation on chromosome 17 in Sequence Viewer

Public Note for CCDS 28624.1
This CCDS ID was withdrawn because the gene is thought to be a pseudogene.

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by CCDS collaboration)

Sequence IDs included in CCDS 28624.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000024121 ENSMUSP00000024121 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000024121Link to Ensembl Protein Viewer:ENSMUSP00000024121Re-query CCDS DB by Nucleotide ID:ENSMUST00000024121Re-query CCDS DB by Protein ID:ENSMUSP00000024121
Original member NCBI NM_001009544.2 NP_001009544.1 Removed not alive Link to Nucleotide Sequence:NM_001009544.2Link to Protein Sequence:NP_001009544.1Re-query CCDS DB by Nucleotide ID:NM_001009544Re-query CCDS DB by Protein ID:NP_001009544Link to BLAST:NP_001009544.1

Chromosomal Locations for CCDS 28624.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 17 (NC_000083.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17See the combined annotation on chromosome 17 in Sequence Viewer

Chromosome Start Stop Links
17 33065100 33067826 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2727 nt):
ATGGCCTTGGTGCCTGTGTATTGTCTTTGTCGACAGCCTTATAATGTGAACCACTTCATGATTGAGTGCG
GC
CTGTGCCAGGACTGGTTTCATGGTAGCTGTGTTGGGATTGAAGAAGAAAACGCTGTTGACATTGACAT
C
TACCACTGCCCAGACTGTGAGGCTGTATTTGGGCCTTCCATTATGAAAAACTGGCATGGATCGCCTAGA
GGG
CATGATGCTCTCAAGAGGAAGCCATTGATGACTGGGAGCCCTACCTCTATTCACCAAATCCAGGGTA
GG
ATTTTTGAAAGCTCTGACAAAGTGATTTTGAAGCCCACAGGAAGTCATTTAACAGTAGAATTTCTGCT
A
GAAAGTAGCTTCAGCATACCTATCCTTGTCTTGAAGAAGGATGGGTTGGGGATGACACTTCCACCGACA
TCA
TTCACTGTCAGAGATGTTGAGCAATATGTTGGTTCTGACAGAGAGGTTGATGTGATTGATGTAGCCT
GT
CAGGCTAGCAGCAAGATGATGTTGGGAGATTTTGTGAAATATTATTACAGCAGGAAGAGGGAAAAGAC
C
TTTAATGTTATTAATTTGGAATTCTCTAATACTGGGCTTTCTAATATAGTAGAGATGCCCAAGATAGTT
CGT
AAGCTTTCCTGGGTTGAAAACTTATGGCCAGAAGATTGCGGCTTTGAGAGACCCAATGTACAGAAGT
AT
TGCCTTATGAGTATGCAGAATAGCTATACAGATTTTCACATTGAATTTGGTGGCACTTCAGCCTGGTA
C
CATGTAGTTAAGGGTGAGAAGATCTTCTATCTGATCCGCCCAACAGATGCTAACCTGACTCTTTTTGAG
TGT
TGGAGCAACTCTTCTAACCAAAAGGAAATATTCTTTGGTGACCAGGTAGACAGATGTTACAAGTGTT
CT
GTGAAGCAAGGACAGACACTTTTCATTCCTACAGGATGGATCTATGCTGTGCTGACCCCAGTGGATTG
C
CTAGCATTTGGGGGAAACTTCTTACACAGTTTAAACATTGAAATGCAGCTCAAAGTCTATGAGATTGAG
AAG
CATCTGTGTACAACAGACCTCTTCAAGTTTCCAAGCTTTGAGACCATCTGTTGGCATGTGGGGAAAC
AC
ATCCTGGACATCTTTAAAGGTTTACGGGAGAATGGGAGATGTCCTGCATCCTTCTTGGTCCATGGTGG
T
AAAGCTCTAAACTTGGCCTTTCAAGCCTGGACAAGGAAAGAAGTTCTGCCTAACCGTGATAATGAGATC
CCA
AAGACAGTGCAGACCATACAGCTCATTGAAGATCTGGCTTGGGAAATTCATCTGGTTGAAGATAATT
TC
CAACAGAACATCCCAAAGACAAGTTCTACCTTTAAGTTCCAGCAGCTCCATACCAATTCCTCTTCCTT
A
ACTAGGCAAGCTCATCCCACTTCAGTATCCAAGTCTAAATTATCACTGCCCTCCAAAAATGGTTCAGAA
AAG
AAAAGCCCAAAGTATAAAGACACCTTTAAGAAGGAAGAACAAATGAGCAAGGAGAGTTCAGCTCTGG
GG
CCTAATTATCAACATAGCTGTAATTTCATGGATCTAAATAATGATCAACAATGGAAGGTAGGCTGTCT
C
CAAAACGTAGAGTTTAACATCACTAGTACTTGTTTGAATGATTCAGATGATAACTCAAAACATGACAAA
GCC
TTCAATGGGAATGAGAGCCTGGTGCCTCTGTTGATGGCTAATGGCAATACGAAGAGGGAAAAGAGCT
TG
TCCGAATCTTGGCAAGCCAAAATCACAAAGAAGGAAGATACATCAAGGTTGATGAAAGAACAAGCGAT
G
GTAGACACATTTGACTTGGATTTAAATGATGAGCTACAGATTGAAAAGGGATTAGGTAAAGAGAAAGTG
AGT
CTGGTAGTAAGACCAAAAATTCCTCCAAGTTTGCCCCATGTGAAGCTTTGCTCTGACCAAAACCAAA
GT
CATGATCCAGGGGAAACTGAGATCACCATTGTAGAGAACTATAAAATAGATAAGGAAATGGTGGAAGA
G
GTTGAAGGCAAGTTTAAGAATGGAAGTGAATCTGGTGGAACTATTGATCCACTAAAGGCCAAGAAACAG
GTG
GGTGGACCTGGCTGTGTTATCCTCACTGATGACCCAAACTCTTCCAGCAATAAGAAGGACATTCAGG
AC
ACTGTGTGCATGTCTGATTTGCAGTCTTCTCCTCCTTCACAAGCTCCCTCCAGCCTTCAGGCATTTTG
G
AGTGGGGGACAAGACCAAGGCAACAAAAGCCCTAGCAGTGTCTTGGGCACAGTGTCTGACAGTCCTGTT
TCT
CGGCGTACCCCAAGGAAATGGCCCATCAAGCGGCTAGCATACTGGAGAAATGAAAGTGAGGCGGGAA
AT
GCTTGTGTAGATGAACAGGGCAGCTTAGGAGCATGCTTCAAGGAAGCTAAGTATATCTTCTTATCCCT
G
GAATCTGATGACGACGACGATGATGATGATGATGACGACGATGACAACAACCCTGCTTTGAGAGTTCTA
CCA
AAGAAAAGGAAGATATCAGATAATGCCCCAAGGATTCCTAGGGCAGATGAGATCCCAACACTACCAA
AG
CAGGACCATTCTGTGCCTGAGGGTAACAGAGTTGGCTCCATTGAGATAGACTGGACTACAGCAGCTAC
A
AAGCTGGCACAGGAGGTGAACAACATGAAGCTCACTCTCACTAGTCCAGGAAAAAGCAGCCAATAA


Translation (908 aa):
MALVPVYCLCRQPYNVNHFMIECGLCQDWFHGSCVGIEEENAVDIDIYHCPDCEAVFGPSIMKNWHGSPR
G
HDALKRKPLMTGSPTSIHQIQGRIFESSDKVILKPTGSHLTVEFLLESSFSIPILVLKKDGLGMTLPPT
S
FTVRDVEQYVGSDREVDVIDVACQASSKMMLGDFVKYYYSRKREKTFNVINLEFSNTGLSNIVEMPKIV
R
KLSWVENLWPEDCGFERPNVQKYCLMSMQNSYTDFHIEFGGTSAWYHVVKGEKIFYLIRPTDANLTLFE
C
WSNSSNQKEIFFGDQVDRCYKCSVKQGQTLFIPTGWIYAVLTPVDCLAFGGNFLHSLNIEMQLKVYEIE
K
HLCTTDLFKFPSFETICWHVGKHILDIFKGLRENGRCPASFLVHGGKALNLAFQAWTRKEVLPNRDNEI
P
KTVQTIQLIEDLAWEIHLVEDNFQQNIPKTSSTFKFQQLHTNSSSLTRQAHPTSVSKSKLSLPSKNGSE
K
KSPKYKDTFKKEEQMSKESSALGPNYQHSCNFMDLNNDQQWKVGCLQNVEFNITSTCLNDSDDNSKHDK
A
FNGNESLVPLLMANGNTKREKSLSESWQAKITKKEDTSRLMKEQAMVDTFDLDLNDELQIEKGLGKEKV
S
LVVRPKIPPSLPHVKLCSDQNQSHDPGETEITIVENYKIDKEMVEEVEGKFKNGSESGGTIDPLKAKKQ
V
GGPGCVILTDDPNSSSNKKDIQDTVCMSDLQSSPPSQAPSSLQAFWSGGQDQGNKSPSSVLGTVSDSPV
S
RRTPRKWPIKRLAYWRNESEAGNACVDEQGSLGACFKEAKYIFLSLESDDDDDDDDDDDDDNNPALRVL
P
KKRKISDNAPRIPRADEIPTLPKQDHSVPEGNRVGSIEIDWTTAATKLAQEVNNMKLTLTSPGKSSQ




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser